The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
80
|
sequence length |
284
|
structure length |
284
|
Chain Sequence |
MSRRYWQLDVFAERPLTGNGLAVFDDASALDDAAMQAWTRELRQFESIFLLPGDDPRAFRARIFTLEEELPFAGHPLLGAAALLHHLRGGDNEQHWTLHLASKSVALRSVRAGSGFYAEMDQGRAEFGATPDAGTCRWFAEAFSLSANDLSGHPPRVVSTGLPYLLLPVTAEALGRARQVNDLQEALDKLGAAFVYLLDVDGREGRTWDNLGLVEDVATGSAAGPVAAYLVEYGLAARGEPFVLHQGRFLERPSRLDVQVATDGSVRVGGHVQLLARAELLTSA
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Structural genomics, unknown function
|
molecule keywords |
gene product PA4716
|
publication title |
The structure of hypothetical protein PA4716 from Pseudomonas aeruginosa
rcsb |
source organism |
Pseudomonas aeruginosa
|
total genus |
80
|
structure length |
284
|
sequence length |
284
|
chains with identical sequence |
B
|
ec nomenclature | |
pdb deposition date | 2004-07-13 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF02567 | PhzC-PhzF | Phenazine biosynthesis-like protein |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | Roll | Diaminopimelate Epimerase; Chain A, domain 1 | Diaminopimelate Epimerase; Chain A, domain 1 | ||
Alpha Beta | Roll | Diaminopimelate Epimerase; Chain A, domain 1 | Diaminopimelate Epimerase; Chain A, domain 1 |
#chains in the Genus database with same CATH superfamily 1U1W A; 1GQZ A; 1W62 A; 1BWZ A; 2OTN A; 4IK0 A; 2H9F A; 4IJZ A; 4K7X A; 4LB0 A; 4Q60 A; 5H2G A; 1SDJ A; 5IWE A; 1U1X A; 2Q9H A; 2GKJ A; 4J9W A; 2GKE A; 4JCI A; 3EKM A; 3EDN A; 1W61 A; 4K7G B; 1QY9 A; 1XUB A; 1T6K A; 4JD7 A; 5M47 A; 2Q9J A; 4K8L A; 1TM0 A; 3EJX A; 3FVE A; 4Q2H A; 1U1V A; 5H2Y A; 4J9X A; 4JUU A; 2AZP A; 5HA4 A; 1S7J A; 1U0K A; 1YM5 A; 4DUN A; 2PW0 A; 1XUA A; 3G7K A; 2PVZ A; 4JBD A; 1QYA A; #chains in the Genus database with same CATH topology 1GQZ A; 2HAW A; 2YMA A; 5H2G A; 3WQZ A; 2Q9H A; 4J9W A; 1T6K A; 2ZXR A; 4LG3 A; 1TM0 A; 4LS9 A; 3FVE A; 4Q2H A; 1S7J A; 1U0K A; 2QB7 A; 1YM5 A; 3G7K A; 2PVZ A; 1U1W A; 1W62 A; 1BWZ A; 5IWE A; 2LT2 A; 2H9F A; 4K7X A; 1U1X A; 1K23 A; 2GKE A; 1K20 A; 5ANP A; 1XUB A; 4RPA A; 4JD7 A; 2Q9J A; 4OA3 A; 2KPT A; 3W5W A; 3PTJ A; 3ICJ A; 3PW9 A; 2ZXO A; 4Q60 A; 3PVH A; 4IJZ A; 4GL6 A; 2QB8 A; 4PY9 A; 3EDN A; 1IR6 A; 1W61 A; 2MPB A; 1QY9 A; 4K7G B; 5M47 A; 2EB0 A; 3DEV A; 3EJX A; 1WPP A; 1U1V A; 2ZVF A; 4J9X A; 4JUU A; 3G98 A; 5HA4 A; 3IGH X; 1I74 A; 2PW0 A; 1QYA A; 2OTN A; 4LB0 A; 2QB6 A; 2IW4 A; 1SDJ A; 2GKJ A; 4JCI A; 2KW7 A; 3EKM A; 4K8L A; 5H2Y A; 1WPM A; 2AZP A; 2ENX A; 4DUN A; 2ZXP A; 1XUA A; 4IK0 A; 4JBD A; #chains in the Genus database with same CATH homology 1GQZ A; 2HAW A; 2YMA A; 5H2G A; 3WQZ A; 2Q9H A; 4J9W A; 1T6K A; 2ZXR A; 4LG3 A; 1TM0 A; 4LS9 A; 3FVE A; 4Q2H A; 1S7J A; 1U0K A; 2QB7 A; 1YM5 A; 3G7K A; 2PVZ A; 1U1W A; 1W62 A; 1BWZ A; 5IWE A; 2LT2 A; 2H9F A; 4K7X A; 1U1X A; 1K23 A; 2GKE A; 1K20 A; 5ANP A; 1XUB A; 4RPA A; 4JD7 A; 2Q9J A; 4OA3 A; 2KPT A; 3W5W A; 3PTJ A; 3ICJ A; 3PW9 A; 2ZXO A; 4Q60 A; 3PVH A; 4IJZ A; 4GL6 A; 2QB8 A; 4PY9 A; 3EDN A; 1IR6 A; 1W61 A; 2MPB A; 1QY9 A; 4K7G B; 5M47 A; 2EB0 A; 3DEV A; 3EJX A; 1WPP A; 1U1V A; 2ZVF A; 4J9X A; 4JUU A; 3G98 A; 5HA4 A; 3IGH X; 1I74 A; 2PW0 A; 1QYA A; 2OTN A; 4LB0 A; 2QB6 A; 2IW4 A; 1SDJ A; 2GKJ A; 4JCI A; 2KW7 A; 3EKM A; 4K8L A; 5H2Y A; 1WPM A; 2AZP A; 2ENX A; 4DUN A; 2ZXP A; 1XUA A; 4IK0 A; 4JBD A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...