The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
32
|
sequence length |
163
|
structure length |
163
|
Chain Sequence |
RTREYTSVITVPNGGHWGKWGIRQFCHSGYANGFALKVEPSQFGRDDTALNGIRLRCLDGSVIESLVGKWGTWTSFLVCPTGYLVSFSLRSEKSQGGGDDTAANNIQFRCSDEAVLVGDGLSWGRFGPWSKRCKICGLQTKVESPQGLRDDTALNNVRFFCCK
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Membrane protein
|
molecule keywords |
VITELLINE MEMBRANE OUTER LAYER PROTEIN I
|
publication title |
Crystal structure of vitelline membrane outer layer protein I (VMO-I): a folding motif with homologous Greek key structures related by an internal three-fold symmetry.
pubmed rcsb |
source organism |
Gallus gallus
|
total genus |
32
|
structure length |
163
|
sequence length |
163
|
chains with identical sequence |
B
|
ec nomenclature | |
pdb deposition date | 1994-01-06 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF03762 | VOMI | Vitelline membrane outer layer protein I (VOMI) |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Aligned Prism | Vitelline Membrane Outer Layer Protein I, subunit A | Vitelline membrane outer layer protein I (VOMI) |
#chains in the Genus database with same CATH superfamily 1VMO A; #chains in the Genus database with same CATH topology 1UGY A; 3R50 A; 3LM1 A; 1J4T A; 4R6O A; 3VZE A; 1OUW A; 4R6N A; 1UH1 A; 4R6Q A; 3LLY A; 1JAC A; 1VBP A; 1DLC A; 3LL2 A; 4PIK A; 4WOG A; 1JOT A; 1VMO A; 2HYR A; 1UGX A; 4D8M A; 1XXQ A; 2HYQ A; 3WOC A; 1WS4 A; 2NU5 A; 3MIU A; 1UGW C; 2GUX A; 1X1V A; 5J4T A; 2GTY A; 1ZGS A; 1XEZ A; 3EB7 A; 4QX2 A; 4ARY A; 4ARX A; 4AK4 A; 3R52 A; 2QP2 A; 1WS5 C; 3LL0 A; 4MQ0 A; 4QX3 A; 2BMY A; 5J50 A; 1XXR A; 1KUJ A; 4AKD A; 5BN6 E; 4R6P A; 1TP8 A; 2JZ4 A; 1KU8 A; 1M26 A; 5AV7 A; 4AKC A; 4PIF A; 1WS4 C; 4QX1 A; 1JI6 A; 3LKY A; 2GUC A; 1VBO A; 5J4X A; 1J4U A; 1UGY C; 1C3M A; 4MOA A; 3MIV A; 4DDN A; 1UH0 A; 1CIY A; 3AQG A; 1ZGR A; 2GUE A; 4PIT A; 3WOB A; 4R6R A; 3TOW A; 1UGW A; 3O44 A; 3VY7 A; 4GX7 A; 3LL1 A; 1PXD A; 3APA A; 5EXG A; 1WS5 A; 3VZG A; 1C3K A; 3LLZ A; 3MIT A; 4AKB A; 1W99 A; 2GUD A; 2BMZ A; 2C9K A; 2BN0 A; 2NUO A; 3R51 A; 4QX0 A; 1C3N A; 3P8S A; 5JM1 A; 3VZF A; 1TOQ A; 1I5P A; 4PIU A; 3VY6 A; 1J4S A; 5J51 A; 4W8J A; #chains in the Genus database with same CATH homology 1VMO A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...