The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
38
|
sequence length |
114
|
structure length |
114
|
Chain Sequence |
MRRVEKVIIVEGRSDKQKVAAVLNEPVVIVCTNGTISDARLEELADELEGYDVYLLADADEAGEKLRRQFRRMFPEAEHLYIDRAYREVAAAPIWHLAQVLLRARFDVRIESLM
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Structural genomics, unknown function
|
molecule keywords |
small TOPRIM domain protein
|
publication title |
Crystal structure and putative function of small Toprim domain-containing protein from Bacillus stearothermophilus.
pubmed doi rcsb |
source organism |
Geobacillus stearothermophilus
|
total genus |
38
|
structure length |
114
|
sequence length |
114
|
chains with identical sequence |
B, C
|
ec nomenclature | |
pdb deposition date | 2005-12-12 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF01751 | Toprim | Toprim domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 3-Layer(aba) Sandwich | Dna Topoisomerase Vi A Subunit; Chain: A, domain 2 | Toprim domain |
#chains in the Genus database with same CATH superfamily 2I5R A; 2FCJ A; #chains in the Genus database with same CATH topology 3VDU A; 1EQN A; 2I5R A; 4O6P B; 2AU3 A; 2V1C A; 1D3Y A; 2Q2E A; 1T6T 1; 4EDV A; 4EDT A; 3VE5 A; 2ZBK A; 4EDG A; 4E2K A; 1DDE A; 3B39 A; 2FCJ A; 3VDP A; 1DD9 A; 1VDD A; 4EDK A; 4JCV A; 4EDR A; 5GUJ A; 4EE1 A; 4O6O A; #chains in the Genus database with same CATH homology 2I5R A; 2FCJ A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...