The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
10
|
sequence length |
71
|
structure length |
71
|
Chain Sequence |
SNAGQLCCLREDGERCGRAAGNASFSKRIQKSISQKKVKIELDKSARHLYICDYHKNLIQSVRNRRKRKGS
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Transcription
|
molecule keywords |
Histone deacetylase complex subunit SAP30
|
publication title |
Solution structure of a novel zinc finger motif in the SAP30 polypeptide of the Sin3 corepressor complex and its potential role in nucleic acid recognition
pubmed doi rcsb |
source organism |
Homo sapiens
|
total genus |
10
|
structure length |
71
|
sequence length |
71
|
ec nomenclature | |
pdb deposition date | 2009-01-14 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 3-Layer(aba) Sandwich | His-Me finger endonuclease fold | His-Me finger endonuclease fold |
#chains in the Genus database with same CATH superfamily 2N1U A; 2KDP A; #chains in the Genus database with same CATH topology 2N1U A; 1EN7 A; 3FC3 A; 1E7D A; 2QNF A; 2QNC A; 3GOX A; 1PZW A; 2KDP A; 1E7L A; #chains in the Genus database with same CATH homology 2N1U A; 2KDP A; 1PZW A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...