The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
51
|
sequence length |
195
|
structure length |
195
|
Chain Sequence |
AVHYQPASPPRDACVYSSCYCEENVWKLCEYIKNHDQYPLEECYAVFISNERKMIPIWKQQARPGDGPVIWDYHVVLLHVSSGGQSFIYDLDTVLPFPCLFDTYVEDAIKSDDDIHPQFRRKFRVICADSYLKNFASDRSHMKDSSGNWREPPPPYPCIETGDSKMNLNDFISMDPKVGWGAVYTLSEFTHRFGS
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Structural genomics, unknown function
|
molecule keywords |
Uncharacterized protein C8orf32
|
publication title |
Crystal structure of the uncharacterized human protein C8orf32 with bound peptide.
rcsb |
source organism |
Homo sapiens
|
total genus |
51
|
structure length |
195
|
sequence length |
195
|
ec nomenclature |
ec
3.5.1.122: Protein N-terminal glutamine amidohydrolase. |
pdb deposition date | 2008-02-18 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF09764 | Nt_Gln_amidase | N-terminal glutamine amidase |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | Roll | C8orf32 fold | Protein N-terminal glutamine amidohydrolase, alpha beta roll |
#chains in the Genus database with same CATH superfamily 3C9Q A; 4W79 A; #chains in the Genus database with same CATH topology 3ESW A; 3A55 A; 2ZK9 X; 4U65 E; 2KSV A; 3A54 A; 3C9Q A; 4FGP A; 2F4M A; 4W79 A; 3A56 A; 4FGQ A; 2F4O A; 3ISR A; 4FGO A; 3KD4 A; #chains in the Genus database with same CATH homology 3C9Q A; 4W79 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...