The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
54
|
sequence length |
227
|
structure length |
227
|
Chain Sequence |
GFVQNIVIDGKNYGGYLVNQYPYMSNPPEVIAWSTTATDLGFVDGTGYQTPDIICHRGAKPGALTAPVSPGGTVELQWTPWPDSHHGPVINYLAPCNGDCSTVDKTQLEFFKIAESGLINDDNPPGIWASDNLIAANNSWTVTIPTTIAPGNYVLRHEIIALHSAQNQDGAQNYPQCINLQVTGGGSDNPAGTLGTALYHDTDPGILINIYQKLSSYIIPGPPLYTG
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule tags |
Hydrolase
|
| molecule keywords |
GH61 ISOZYME A
|
| publication title |
Insights Into the Oxidative Degradation of Cellulose by a Copper Metalloenzyme that Exploits Biomass Components.
pubmed doi rcsb |
| source organism |
Thermoascus aurantiacus
|
| total genus |
54
|
| structure length |
227
|
| sequence length |
227
|
| ec nomenclature |
ec
3.2.1.4: Cellulase. |
| pdb deposition date | 2011-07-18 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF03443 | Glyco_hydro_61 | Glycosyl hydrolase family 61 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Distorted Sandwich | Coagulation Factor XIII; Chain A, domain 1 | Coagulation Factor XIII; Chain A, domain 1 |
#chains in the Genus database with same CATH superfamily 4B5Q A; 5ACH A; 4EIS B; 4D7V A; 2VTC A; 5FOH A; 2YET A; 3EJA A; 4D7U A; 3ZUD A; 3EII A; 5ACI A; 5ACJ A; 4QI8 A; 4MAH A; 4FMR A; 4EIR A; 4EIS A; 5ACG A; 5ACF A; 4MAI A; #chains in the Genus database with same CATH topology 5HNO A; 5L7K A; 2JHV A; 5E80 A; 4EIS B; 1FST A; 4ALS A; 3T5I A; 2YOX A; 2R5O A; 4LN0 A; 5FOH A; 3EJA A; 4GOJ C; 2LHS A; 4D7U A; 4ALE A; 4OY8 A; 2XWX A; 4MAH A; 5TAR B; 1GDF A; 2BXW A; 3KYS A; 4OY7 A; 1FT3 A; 2JHS A; 5FTZ A; 2JHU A; 4D7V A; 4JV8 B; 3GQQ A; 2YOW A; 3ZUD A; 5ACI A; 5ACJ A; 4FMR A; 1DOA B; 2JHY A; 4JVF B; 4EIS A; 1KSJ B; 4ALT A; 5ACG A; 1DS6 B; 4MAI A; 4F38 B; 4JV6 B; 5TB5 B; 5F2U A; 3JUA A; 4GBO A; 2YET A; 4ALQ A; 5EMV A; 3EII A; 4JVB B; 1FT0 A; 4QI8 A; 1AJW A; 4A02 A; 5EMW A; 2JHX A; 5E8F A; 2BEN A; 5DQ8 A; 1KMT A; 2JHW A; 2YOY A; 4JHP B; 1KSH B; 4B5Q A; 5ACH A; 4ALC A; 4OY6 A; 1FSO A; 3L15 A; 5FJQ A; 3RBQ A; 5DQE A; 2VTC A; 2JHT A; 2JHZ A; 4ALR A; 5AA7 A; 5IJU A; 5HNP A; 3T5G B; 4EIR A; 1HH4 D; 2BEM A; 1QVY A; 5HGU A; 3UAM A; 4RE1 A; 1RHO A; 2JI0 A; 1KSG B; 5ACF A; 4GOK C; #chains in the Genus database with same CATH homology 4B5Q A; 5ACH A; 4EIS B; 3L15 A; 4D7V A; 3JUA A; 5DQE A; 2VTC A; 4LN0 A; 5FOH A; 2YET A; 3EJA A; 5EMV A; 4D7U A; 3ZUD A; 3EII A; 5ACI A; 5ACJ A; 4QI8 A; 4MAH A; 4FMR A; 5EMW A; 4EIR A; 5DQ8 A; 5HGU A; 4RE1 A; 4EIS A; 5ACG A; 3KYS A; 5ACF A; 4MAI A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
