3RIIA

Crystal structure of the catalytic domain of uchl5, a proteasome-associated human deubiquitinating enzyme, reveals an unproductive form of the enzyme
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
Knots found
sequence length
222
structure length
212
Chain Sequence
GEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGSVVQDSRLDTIFFAKQVINNASATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSDVIRQVHNSFARQAKEEDAFHFVSYVPVNGRLYELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin carboxyl-terminal hydrolase isozyme L5
publication title Crystal structure of the catalytic domain of UCHL5, a proteasome-associated human deubiquitinating enzyme, reveals an unproductive form of the enzyme.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 68
structure length 212
sequence length 222
chains with identical sequence B
other databases KnotProt 2.0: K -52 -31 -31
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2011-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01088 Peptidase_C12 Ubiquitin carboxyl-terminal hydrolase, family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.532.10 Alpha Beta 3-Layer(aba) Sandwich Ubiquitin C-terminal Hydrolase UCH-l3 Peptidase C12, ubiquitin carboxyl-terminal hydrolase 3riiA00
3RISA 3RIIA 1CMXA 3KW5A 3IRTA 2LENA 4IG7A 1XD3A 2ETLA 4I6NA 4JKJA 3TB3A 1UCHA 4DM9A 3IHRA 3KVFA 4UELA 3A7SA 4UEMA 3IFWA
chains in the Genus database with same CATH superfamily
3RISA 3RIIA 1CMXA 3KW5A 3IRTA 2LENA 4IG7A 1XD3A 2ETLA 4I6NA 4JKJA 3TB3A 1UCHA 4DM9A 3IHRA 3KVFA 4UELA 3A7SA 4UEMA 3IFWA
chains in the Genus database with same CATH topology
3RISA 3RIIA 1CMXA 3KW5A 3IRTA 2LENA 4IG7A 1XD3A 2ETLA 4I6NA 4JKJA 3TB3A 1UCHA 4DM9A 3IHRA 3KVFA 4UELA 3A7SA 4UEMA 3IFWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RIS A;  3RII A;  1CMX A;  3KW5 A;  3IRT A;  2LEN A;  4IG7 A;  1XD3 A;  2ETL A;  4I6N A;  4JKJ A;  3TB3 A;  1UCH A;  4DM9 A;  3IHR A;  3KVF A;  4UEL A;  3A7S A;  4UEM A;  3IFW A; 
#chains in the Genus database with same CATH topology
 3RIS A;  3RII A;  1CMX A;  3KW5 A;  3IRT A;  2LEN A;  4IG7 A;  1XD3 A;  2ETL A;  4I6N A;  4JKJ A;  3TB3 A;  1UCH A;  4DM9 A;  3IHR A;  3KVF A;  4UEL A;  3A7S A;  4UEM A;  3IFW A; 
#chains in the Genus database with same CATH homology
 3RIS A;  3RII A;  1CMX A;  3KW5 A;  3IRT A;  2LEN A;  4IG7 A;  1XD3 A;  2ETL A;  4I6N A;  4JKJ A;  3TB3 A;  1UCH A;  4DM9 A;  3IHR A;  3KVF A;  4UEL A;  3A7S A;  4UEM A;  3IFW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...