The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
69
|
Knots found |
|
sequence length |
233
|
structure length |
227
|
Chain Sequence |
EWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDTKDAFHFVSYVPVNGRLYELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIAELQ
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Crystal structure of the catalytic domain of UCHL5, a proteasome-associated human deubiquitinating enzyme, reveals an unproductive form of the enzyme.
pubmed doi rcsb |
molecule tags |
Hydrolase
|
source organism |
Homo sapiens
|
molecule keywords |
Ubiquitin carboxyl-terminal hydrolase isozyme L5
|
total genus |
69
|
structure length |
227
|
sequence length |
233
|
chains with identical sequence |
B, C, D
|
other databases |
KnotProt 2.0: K -52 -31 -31
|
ec nomenclature |
ec
3.4.19.12: Ubiquitinyl hydrolase 1. |
pdb deposition date | 2011-04-14 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF01088 | Peptidase_C12 | Ubiquitin carboxyl-terminal hydrolase, family 1 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 3-Layer(aba) Sandwich | Ubiquitin C-terminal Hydrolase UCH-l3 | Peptidase C12, ubiquitin carboxyl-terminal hydrolase |
#chains in the Genus database with same CATH superfamily 3TB3 A; 4UEM A; 1UCH A; 3KW5 A; 1CMX A; 4UEL A; 2ETL A; 2LEN A; 1XD3 A; 3IFW A; 4IG7 A; 4I6N A; 4JKJ A; 4DM9 A; 3RIS A; 3IHR A; 3A7S A; 3IRT A; 3RII A; 3KVF A; #chains in the Genus database with same CATH topology 3TB3 A; 4UEM A; 1UCH A; 3KW5 A; 1CMX A; 4UEL A; 2ETL A; 2LEN A; 1XD3 A; 3IFW A; 4IG7 A; 4I6N A; 4JKJ A; 4DM9 A; 3RIS A; 3IHR A; 3A7S A; 3IRT A; 3RII A; 3KVF A; #chains in the Genus database with same CATH homology 3TB3 A; 4UEM A; 1UCH A; 3KW5 A; 1CMX A; 4UEL A; 2ETL A; 2LEN A; 1XD3 A; 3IFW A; 4IG7 A; 4I6N A; 4JKJ A; 4DM9 A; 3RIS A; 3IHR A; 3A7S A; 3IRT A; 3RII A; 3KVF A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...