The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
41
|
sequence length |
168
|
structure length |
168
|
Chain Sequence |
SQHMAFARDTEVYYENDTVPHMESIEEMYSKYASMNGELPFDNGYAVPLDNVFVYTLDIASGEIKKTRASYIYREKVEKLIEIKLSSGYSLKVTPSHPVLLFRDGLQWVPAAEVKPGDVVVGVRNGELEFHEVSSVRIIDYNNWVYDLVIPETHNFIAPNGLVLHNAQ
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Unknown function
|
molecule keywords |
Pho radA intein
|
publication title |
NMR and Crystal Structures of the Pyrococcus horikoshii RadA Intein Guide a Strategy for Engineering a Highly Efficient and Promiscuous Intein.
pubmed doi rcsb |
source organism |
Pyrococcus horikoshii
|
total genus |
41
|
structure length |
168
|
sequence length |
168
|
ec nomenclature | |
pdb deposition date | 2012-03-09 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF14890 | Intein_splicing | Intein splicing domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Beta Complex | Endonuclease - Pi-scei; Chain A, domain 1 | Hedgehog/Intein (Hint) domain |
#chains in the Genus database with same CATH superfamily 1LWT A; 2IMZ A; 1ZDE A; 1AM2 A; 2IN8 A; 2JNQ A; 2CW7 A; 2LQM A; 3NZM A; 4GIG A; 1DQ3 A; 1JVA A; 1MI8 A; 3IGD A; 5I0A A; 1VDE A; 1DFA A; 2LCJ A; 4O1R A; 4OZ6 A; 2IN9 A; 1AT0 A; 1UM2 A; 2L8L A; 2KEQ A; 2LWY A; 2IN0 A; 4KL5 A; 2JMZ A; 2CW8 A; 4E2T A; 1EF0 A; 1GPP A; 4KL6 A; 4O1S A; 1LWS A; 1ZD7 A; 3IFJ A; 4E2U A; 5K08 A; #chains in the Genus database with same CATH topology 4LX3 A; 1LWT A; 2IMZ A; 1ZDE A; 1AM2 A; 2IN8 A; 2JNQ A; 2CW7 A; 2LQM A; 3NZM A; 4GIG A; 1DQ3 A; 1JVA A; 1MI8 A; 3IGD A; 4QFQ A; 1VDE A; 1DFA A; 5I0A A; 2LCJ A; 4O1R A; 4OZ6 A; 2IN9 A; 1AT0 A; 1UM2 A; 2L8L A; 2KEQ A; 2LWY A; 2IN0 A; 4KL5 A; 2JMZ A; 2CW8 A; 4E2T A; 1EF0 A; 1GPP A; 4KL6 A; 4O1S A; 1LWS A; 1ZD7 A; 3IFJ A; 4E2U A; 5K08 A; #chains in the Genus database with same CATH homology 1LWT A; 2IMZ A; 1ZDE A; 1AM2 A; 2IN8 A; 2JNQ A; 2CW7 A; 2LQM A; 3NZM A; 4GIG A; 1DQ3 A; 1JVA A; 1MI8 A; 3IGD A; 5I0A A; 1VDE A; 1DFA A; 2LCJ A; 4O1R A; 4OZ6 A; 2IN9 A; 1AT0 A; 1UM2 A; 2L8L A; 2KEQ A; 2LWY A; 2IN0 A; 4KL5 A; 2JMZ A; 2CW8 A; 4E2T A; 1EF0 A; 1GPP A; 4KL6 A; 4O1S A; 1LWS A; 1ZD7 A; 3IFJ A; 4E2U A; 5K08 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...