The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
53
|
sequence length |
276
|
structure length |
266
|
Chain Sequence |
GDTPSNPLRPIADDTIDHASHTPGSVSSAFILEAMVNVISGPKVLMKQIPIWLPLGVADQKTYSFDSTTAAIMLASYTITHFGKATNPLVRVNRLGPGIPDHPLRLLRIGNQAFLQEFVLPPVQLPQYFTFDLTALKLITQPLPAATWTDDPTGSNGALRPGISFHPKLRPILLPNKLTSPEKIQAIMTSLQDFKIVPIDPTKNIMGIEVPETLVHKLTGKKVTSKNGQPIIPVLLPKYIGLDPVAPGDLTMVITQDCDTCHSPAS
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Viral protein
|
molecule keywords |
Matrix protein VP40
|
publication title |
Structural Rearrangement of Ebola Virus VP40 Begets Multiple Functions in the Virus Life Cycle.
pubmed doi rcsb |
source organism |
Ebola virus
|
total genus |
53
|
structure length |
266
|
sequence length |
276
|
chains with identical sequence |
B, C, D
|
ec nomenclature | |
pdb deposition date | 2013-06-24 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Sandwich | EV matrix protein fold | EV matrix protein | ||
Mainly Beta | Distorted Sandwich | Topoisomerase I; domain 3 | Topoisomerase I; domain 3 |
#chains in the Genus database with same CATH superfamily 3TCQ A; 1ES6 A; 4LDD A; 1H2D A; 5B0V A; 4LDB A; 4LDM A; 1H2C A; 4LD8 A; #chains in the Genus database with same CATH topology 1CY0 A; 4HIY A; 1I7D A; 1GL9 B; 2O19 A; 1CY1 A; 4G1O A; 1CY6 A; 4DDW A; 3F1J A; 1CY2 A; 4DDT A; 4DDV A; 1MW9 X; 2O5E A; 1CY8 A; 4LD8 A; 4HI5 A; 2O54 A; 1ES6 A; 4G1G A; 4CGY A; 3PWT A; 5B0V A; 4RUL A; 4V23 A; 1MW8 X; 4HI6 A; 1GKU B; 4HIW A; 1D6M A; 2YKD A; 2GAI A; 2O5C A; 4LDB A; 5D5H A; 3PX7 A; 1CY7 A; 1CY4 A; 4LDM A; 4D4T A; 1H2C A; 2GAJ A; 2VQP A; 3TCQ A; 4G1L A; 4HIT A; 4CHT A; 4LDD A; 1H2D A; 4DDU A; 4HIU A; 2O59 A; 1CY9 A; 4LP7 A; 1CYY A; 1ECL A; #chains in the Genus database with same CATH homology 4G1O A; 3F1J A; 4LD8 A; 4HI5 A; 1ES6 A; 4G1G A; 5B0V A; 4V23 A; 4HI6 A; 4HIW A; 2YKD A; 4LDB A; 4LDM A; 4D4T A; 1H2C A; 2VQP A; 3TCQ A; 4G1L A; 4HIT A; 4LDD A; 1H2D A; 4HIU A; 4LP7 A; 4HIY A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...