The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
98
|
sequence length |
274
|
structure length |
274
|
Chain Sequence |
MSGRVGDLSPRQKEALAKFRENVQDVLPALPNPDDYFLLRWLRARSFDLQKSEAMLRKHVEFRKQKDIDNIISWQPPEVIQQYLSGGMCGYDLDGCPVWYDIIGPLDAKGLLFSASKQDLLRTKMRECELLLQECAHQTTKLGRKVETITIIYDCEGLGLKHLWKPAVEAYGEFLCMFEENYPETLKRLFVVKAPKLFPVAYNLIKPFLSEDTRKKIMVLGANWKEVLLKHISPDQVPVEYGGTMTDPDGNPKCKSKINYGGDIPRKYYVRDQV
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Transport protein
|
molecule keywords |
SEC14-like protein 2
|
publication title |
Structural insights on cholesterol endosynthesis: Binding of squalene and 2,3-oxidosqualene to supernatant protein factor.
pubmed doi rcsb |
source organism |
Homo sapiens
|
total genus |
98
|
structure length |
274
|
sequence length |
274
|
chains with identical sequence |
B
|
ec nomenclature | |
pdb deposition date | 2014-01-27 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00650 | CRAL_TRIO | CRAL/TRIO domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 3-Layer(aba) Sandwich | Phosphatidylinositol Transfer Protein Sec14p | CRAL-TRIO lipid binding domain |
#chains in the Genus database with same CATH superfamily 4UYB A; 4CIZ A; 1OIP A; 4CJ6 A; 3P7Z A; 3PG7 A; 1O6U A; 3HX3 A; 4J7P A; 4FMM A; 3PEG A; 4OMK A; 1OIZ A; 1R5L A; 4OMJ A; 1AUA A; 4TLG A; 3HY5 A; 3W67 A; 3Q8G A; 2D4Q A; 1OLM A; 2E2X A; 3W68 A; 3B74 A; 4J7Q A; 1OLM E; 3B7Q A; 3B7Z A; 3B7N A; 4M8Z A; #chains in the Genus database with same CATH topology 4UYB A; 4CIZ A; 1OIP A; 4CJ6 A; 3P7Z A; 3PG7 A; 1O6U A; 3HX3 A; 4J7P A; 4FMM A; 3PEG A; 4OMK A; 1OIZ A; 1R5L A; 4OMJ A; 1AUA A; 4TLG A; 3HY5 A; 3W67 A; 3Q8G A; 2D4Q A; 1OLM A; 2E2X A; 3W68 A; 3B74 A; 4J7Q A; 1OLM E; 3B7Q A; 3B7Z A; 3B7N A; 4M8Z A; #chains in the Genus database with same CATH homology 4UYB A; 4CIZ A; 1OIP A; 4CJ6 A; 3P7Z A; 3PG7 A; 1O6U A; 3HX3 A; 4J7P A; 4FMM A; 3PEG A; 4OMK A; 1OIZ A; 1R5L A; 4OMJ A; 1AUA A; 4TLG A; 3HY5 A; 3W67 A; 3Q8G A; 2D4Q A; 1OLM A; 2E2X A; 3W68 A; 3B74 A; 4J7Q A; 1OLM E; 3B7Q A; 3B7Z A; 3B7N A; 4M8Z A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...