The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
45
|
sequence length |
167
|
structure length |
164
|
Chain Sequence |
EEVSVEELKAIQLRTTNEATGEKRFGSARAIIEDLTIYKSDGTTLAEKPLIKSGEEVTFDFTILASEEIKDIALGISMSKAQGGDIWGDSNIGAGSAITLRPGRQRIVYKATLPINSGDYLIHCGLAKVGREELDQRRPMMKVKFWSARELGGVIHAPLKIISN
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Transport protein
|
molecule keywords |
ABC type transport system putative ATP binding protein
|
publication title |
The Klebsiella pneumoniae O12 ATP-binding Cassette (ABC) Transporter Recognizes the Terminal Residue of Its O-antigen Polysaccharide Substrate.
pubmed doi rcsb |
source organism |
Raoultella terrigena
|
total genus |
45
|
structure length |
164
|
sequence length |
167
|
chains with identical sequence |
B, C
|
ec nomenclature | |
pdb deposition date | 2016-01-18 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF14524 | Wzt_C | Wzt C-terminal domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Distorted Sandwich | Coagulation Factor XIII; Chain A, domain 1 | abc- transporter (atp binding component) like domain |
#chains in the Genus database with same CATH superfamily 5HNP A; 5HNO A; 2R5O A; #chains in the Genus database with same CATH topology 1FSO A; 2XWX A; 5AA7 A; 5EMV A; 2JHZ A; 5HNP A; 4GBO A; 4ALQ A; 4ALT A; 5IJU A; 4D7V A; 4ALE A; 2YOY A; 4ALC A; 3JUA A; 3L15 A; 5ACH A; 4OY7 A; 5F2U A; 5ACJ A; 2JI0 A; 4B5Q A; 3T5I A; 1KMT A; 1KSJ B; 3ZUD A; 1KSH B; 5L7K A; 5ACI A; 5EMW A; 5HGU A; 5HNO A; 3UAM A; 4ALR A; 3KYS A; 5E80 A; 1DOA B; 4LN0 A; 2JHT A; 3EII A; 2BXW A; 5ACF A; 2BEN A; 4JV8 B; 2JHX A; 1HH4 D; 2JHW A; 2JHU A; 4RE1 A; 1GDF A; 2YOW A; 4OY8 A; 2VTC A; 1FT0 A; 2JHS A; 4OY6 A; 3T5G B; 2YET A; 5FTZ A; 4EIS A; 3GQQ A; 4EIR A; 1AJW A; 4QI8 A; 1FT3 A; 4F38 B; 4JVB B; 2YOX A; 4FMR A; 1FST A; 4A02 A; 3RBQ A; 4EIS B; 4GOK C; 3EJA A; 5ACG A; 1DS6 B; 5DQ8 A; 5FJQ A; 5DQE A; 1KSG B; 4MAI A; 5E8F A; 4GOJ C; 2BEM A; 2LHS A; 5FOH A; 1RHO A; 4JVF B; 4ALS A; 1QVY A; 2R5O A; 4JV6 B; 4D7U A; 2JHY A; 4JHP B; 4MAH A; 2JHV A; 5TB5 B; 5TAR B; #chains in the Genus database with same CATH homology 5HNP A; 5HNO A; 2R5O A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...