The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
15
|
sequence length |
89
|
structure length |
89
|
Chain Sequence |
QMSFTFASPTQVFFNSANVRQVDVPTQTGAFGILAAHVPTLQVLRPGLVVVHAEDGTTSKYFVSSGSVTVNADSSVQLLAEEAVTLDML
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule tags |
Hydrolase
|
| molecule keywords |
BOVINE MITOCHONDRIAL F1-ATPASE
|
| publication title |
Structure of Bovine Mitochondrial F1-ATPase with Nucleotide Bound to All Three Catalytic Sites: Implications for the Mechanism of Rotary Catalysis
pubmed doi rcsb |
| total genus |
15
|
| structure length |
89
|
| sequence length |
89
|
| ec nomenclature | |
| pdb deposition date | 2001-02-02 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| H | PF02823 | ATP-synt_DE_N | ATP synthase, Delta/Epsilon chain, beta-sandwich domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Sandwich | ATP Synthase; domain 1 | F0F1 ATP synthase delta/epsilon subunit, N-terminal |
#chains in the Genus database with same CATH superfamily 1H8E H; 3OEH H; 3OFN H; 2QE7 H; 2V7Q H; 1BSH A; 5FL7 H; 2XND H; 1E79 H; 3OE7 H; 2E5Y A; 2RQ6 A; 2HLD H; 2WSS H; 2XOK H; 2RQ7 A; 1FS0 E; 3FKS H; 1BSN A; 1AQT A; 5DN6 I; 4ASU H; 3OAA H; 4YXW H; #chains in the Genus database with same CATH topology 1H8E H; 3OEH H; 3OFN H; 2QE7 H; 2V7Q H; 1BSH A; 5FL7 H; 2XND H; 1E79 H; 3OE7 H; 2E5Y A; 2RQ6 A; 2HLD H; 2WSS H; 2XOK H; 2RQ7 A; 1FS0 E; 3FKS H; 1BSN A; 1AQT A; 5DN6 I; 4ASU H; 3OAA H; 4YXW H; #chains in the Genus database with same CATH homology 1H8E H; 3OEH H; 3OFN H; 2QE7 H; 2V7Q H; 1BSH A; 5FL7 H; 2XND H; 1E79 H; 3OE7 H; 2E5Y A; 2RQ6 A; 2HLD H; 2WSS H; 2XOK H; 2RQ7 A; 1FS0 E; 3FKS H; 1BSN A; 1AQT A; 5DN6 I; 4ASU H; 3OAA H; 4YXW H;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
