The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
131
|
sequence length |
313
|
structure length |
313
|
Chain Sequence |
VLRGTVTDFPGFDGRADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLC
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule tags |
Calcium/phospholipid binding
|
| molecule keywords |
ANNEXIN V
|
| publication title |
Structural and electrophysiological analysis of annexin V mutants. Mutagenesis of human annexin V, an in vitro voltage-gated calcium channel, provides information about the structural features of the ion pathway, the voltage sensor and the ion selectivity filter
pubmed doi rcsb |
| source organism |
Homo sapiens
|
| total genus |
131
|
| structure length |
313
|
| sequence length |
313
|
| ec nomenclature | |
| pdb deposition date | 1994-06-29 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF00191 | Annexin | Annexin |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Orthogonal Bundle | Annexin V; domain 1 | Annexin | ||
| Mainly Alpha | Orthogonal Bundle | Annexin V; domain 1 | Annexin | ||
| Mainly Alpha | Orthogonal Bundle | Annexin V; domain 1 | Annexin | ||
| Mainly Alpha | Orthogonal Bundle | Annexin V; domain 1 | Annexin |
#chains in the Genus database with same CATH superfamily 1M9I A; 1XJL A; 1BCW A; 1BC3 A; 1N42 A; 1AII A; 1ANN A; 1HM6 A; 2H0K A; 1DM5 A; 1AEI A; 1AVH A; 1AOW A; 1W7B A; 2XO3 A; 2ZHJ A; 4EVH A; 1HVF A; 1BC1 A; 2H0L A; 1N44 A; 2IE6 A; 1AXN A; 1BO9 A; 1AVC A; 2ZOC A; 4HRE A; 2II2 A; 1BCZ A; 1MCX A; 2HYW A; 2XO2 A; 1BC0 A; 1W3W A; 2IE7 A; 1HAK A; 1W45 A; 1YCN A; 1ANW A; 4X9P A; 1DK5 A; 4MDV A; 1N41 A; 2H0M A; 4MDU A; 1HVG A; 1YII A; 2HYV A; 1ALA A; 1AVR A; 2IIC A; 2RAN A; 1A8A A; 1BCY A; 1ANX A; 1HVD A; 2HYU A; 2Q4C A; 2ZHI A; 1A8B A; 1YJ0 A; 1I4A A; 4EVF A; 1G5N A; 1SAV A; 1HVE A; 1N00 A; 3BRX A; #chains in the Genus database with same CATH topology 1R8S E; 1M9I A; 1UPT B; 1BC3 A; 2H0K A; 4EVH A; 1AOW A; 2R09 A; 1HVF A; 2H0L A; 2IE6 A; 3ABS A; 4JK1 X; 1AVC A; 1LKV X; 2II2 A; 4JXH A; 1BC0 A; 1R4A E; 1W3W A; 3L8N A; 1YCN A; 3ABQ A; 1XSZ A; 1DK5 A; 4MDV A; 1N41 A; 2H0M A; 2HYV A; 3ABR A; 1A8A A; 4C7P A; 1ANX A; 2ZHI A; 2HSN A; 1I4A A; 4FQ0 C; 4D7R A; 3AJC A; 1XJL A; 4OIY A; 1DM5 A; 1W7B A; 2XO3 A; 2ZHJ A; 1S9D E; 1BC1 A; 4Z21 A; 2ZOC A; 3LTL A; 1HAK A; 1XT0 B; 4JMI A; 4KN7 X; 4C0A A; 1HVG A; 4KMU X; 3USY A; 2RAN A; 4D7Q A; 2OY9 A; 2R0D A; 1YJ0 A; 3USW A; 3BRX A; 3SOH B; 2K6X A; 1C1K A; 1BCW A; 4A4P A; 1ANN A; 1AEI A; 4JMO A; 4JWL A; 4FHR B; 1Q8D A; 1BO9 A; 1N44 A; 1AXN A; 1BCZ A; 1MCX A; 4KN4 X; 3ABO A; 2IE7 A; 1W45 A; 1BC9 A; 1ANW A; 4X9P A; 1PBV A; 1YGM A; 1YII A; 1R8M E; 1RE0 B; 1AVR A; 3ANY A; 1HVD A; 2HYU A; 2VXG A; 1A8B A; 2QEZ A; 1G5N A; 3TW5 A; 3HJL A; 1N00 A; 1R8Q E; 1N42 A; 1AII A; 1HM6 A; 4Q2S A; 1AVH A; 4HRE A; 2HYW A; 2XO2 A; 3SWV A; 1KU1 A; 4MDU A; 1QC7 A; 1ALA A; 2IIC A; 4L5M A; 2Q4C A; 1BCY A; 4EVF A; 3AO0 A; 1SAV A; 1HVE A; #chains in the Genus database with same CATH homology 1M9I A; 1XJL A; 1BCW A; 1BC3 A; 1N42 A; 1AII A; 1ANN A; 1HM6 A; 2H0K A; 1DM5 A; 1AEI A; 1AVH A; 1AOW A; 1W7B A; 2XO3 A; 2ZHJ A; 4EVH A; 1HVF A; 1BC1 A; 2H0L A; 1N44 A; 2IE6 A; 1AXN A; 1BO9 A; 1AVC A; 2ZOC A; 4HRE A; 2II2 A; 1BCZ A; 1MCX A; 2HYW A; 2XO2 A; 1BC0 A; 1W3W A; 2IE7 A; 1HAK A; 1W45 A; 1YCN A; 1ANW A; 4X9P A; 1DK5 A; 4MDV A; 1N41 A; 2H0M A; 4MDU A; 1HVG A; 1YII A; 2HYV A; 1ALA A; 1AVR A; 2IIC A; 2RAN A; 1A8A A; 1BCY A; 1ANX A; 1HVD A; 2HYU A; 2Q4C A; 2ZHI A; 1A8B A; 1YJ0 A; 1I4A A; 4EVF A; 1G5N A; 1SAV A; 1HVE A; 1N00 A; 3BRX A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
