The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
20
|
sequence length |
86
|
structure length |
86
|
Chain Sequence |
HVVYVGNKPVMNYVLATLTQLNEGADEVVIKARGRAISRAVDVAEIVRNRFMPGVKVKEIKIDTEELESEQGRRSNVSTIEIVLAK
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Gene regulation
|
molecule keywords |
conserved hypothetical protein AF1956
|
publication title |
Structure of a Sir2 substrate, Alba, reveals a mechanism for deacetylation-induced enhancement of DNA-binding
pubmed doi rcsb |
source organism |
Archaeoglobus fulgidus
|
total genus |
20
|
structure length |
86
|
sequence length |
86
|
chains with identical sequence |
B
|
ec nomenclature | |
pdb deposition date | 2002-12-15 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF01918 | Alba | Alba |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 2-Layer Sandwich | Translation Initiation Factor IF3 | Alba-like domain |
#chains in the Genus database with same CATH superfamily 2EK0 A; 3IAB B; 1NFJ A; 3WBM A; 1VM0 A; 2Z7C A; 2EH1 A; 1NH9 A; 1Y9X A; 3IAB A; 1UDV A; 3U6Y A; 2Q3V A; 1NFH A; 2A2Y A; 1H0Y A; 2BKY X; 4Z9E A; 3TOE A; 1H0X A; 2H9U A; #chains in the Genus database with same CATH topology 3LVJ C; 3TTC A; 3QKB A; 3IAB B; 1RQ8 A; 2L8Y A; 1VM0 A; 2Z7C A; 2LXR A; 1NH9 A; 3DSD A; 1H4T A; 1XEZ A; 2A2Y A; 3DSC A; 3TSU A; 1II7 A; 1NJ5 A; 4NZR M; 4HVZ A; 3LVK B; 4YKE A; 4HD0 A; 1JE3 A; 4FCX A; 1HC7 A; 4FBQ A; 2LN3 A; 1H4Q A; 4FBW A; 2GTC A; 1H4S A; 1NJ2 A; 3TSP A; 2EH1 A; 1JO0 A; 1Y9X A; 1DCJ A; 4NZT M; 3T1I A; 3TSQ A; 2Q3V A; 3ZIG A; 1H0Y A; 1Y2I A; 1TIG A; 4WI1 A; 2BKY X; 4Z9E A; 3P04 A; 4TWA A; 1H0X A; 1NJ6 A; 2Y1B A; 1JDQ A; 2H9U A; 1S8E A; 3VTH A; 3ZIH A; 4Q15 A; 4HVC A; 3IAB A; 4OLF A; 1NJ8 A; 3TTD A; 2CRQ A; 1NFH A; 3HZ7 A; 3ZII A; 3VTI A; 4EO0 A; 1VR4 A; 2IFE A; 1LN4 A; 3TTF A; 1NJ1 A; 2P9B A; 3ZIE A; 2EK0 A; 1NFJ A; 3WBM A; 4YDQ A; 4NCX A; 1UDV A; 3U6Y A; 4FBK A; 4K88 A; 3IAL A; 3TOE A; 4K86 A; 1PAV A; 2M71 A; 4K87 A; #chains in the Genus database with same CATH homology 2EK0 A; 3IAB B; 1NFJ A; 3WBM A; 1VM0 A; 2Z7C A; 2EH1 A; 1NH9 A; 1Y9X A; 3IAB A; 1UDV A; 3U6Y A; 2Q3V A; 1NFH A; 2A2Y A; 1H0Y A; 2BKY X; 4Z9E A; 3TOE A; 1H0X A; 2H9U A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...