The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
62
|
sequence length |
148
|
structure length |
148
|
Chain Sequence |
LHALVDLGERLTTLKADVLAKLPLTDALRKALAEAPKHTANIARKRHILFIGKLMRDQDQEAILVLLDQLDASTRQYNERFHNLERWRDRLIAGDDADLEKFVIEYPDADRQQLRSLIRQAQHEVARNKPPATSRKIFKYIRELDELQ
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Structural genomics, unknown function
|
molecule keywords |
UPF0307 protein PSPTO_4464
|
publication title |
The crystal structure of a conserved putative protein from Pseudomonas syringae pv. tomato str. DC3000
rcsb |
source organism |
Pseudomonas syringae pv. tomato
|
total genus |
62
|
structure length |
148
|
sequence length |
148
|
ec nomenclature | |
pdb deposition date | 2007-03-01 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF04751 | DUF615 | Protein of unknown function (DUF615) |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | Diphtheria Toxin Repressor; domain 2 | PSPTO4464-like domains | ||
Mainly Alpha | Orthogonal Bundle | Diphtheria Toxin Repressor; domain 2 | PSPTO4464-like domains |
#chains in the Genus database with same CATH superfamily 2P0T A; #chains in the Genus database with same CATH topology 1BI2 A; 1FWZ A; 2H09 A; 2M35 A; 3R61 A; 1DDN A; 1BI0 A; 1P92 A; 1XCV A; 2F5D A; 3J7A W; 2ISZ A; 2QQ9 A; 5IT9 R; 5FLX R; 2X98 A; 1F5T A; 1C0W A; 2EV0 A; 3R60 A; 2HYF A; 4O5V A; 1G3S A; 2QQA A; 2P0T A; 1G3T A; 2F5C A; 2HYG D; 4HV5 A; 1U8R A; 1BI3 A; 1ON2 A; 4HX8 A; 1G3W A; 4HV6 A; 2TDX A; 1BI1 A; 2DTR A; 1FX7 A; 2F5F A; 4HX7 A; 3A52 A; 2MZ4 A; 2EV5 A; 1DPR A; 4O6J A; 2QQB A; 3J80 R; 4HX4 A; 2F5E A; 2MVT A; 1ON1 A; 3GLX A; 1B1B A; 2MUN A; 1RQ6 A; 5A2Q R; 1G3Y A; 2EV6 A; 3J81 R; 3JAM R; #chains in the Genus database with same CATH homology 2P0T A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...