The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
41
|
sequence length |
201
|
structure length |
201
|
Chain Sequence |
YEETPDVIGKSVKEAEQIFNKNNLKLGKISRSYSDKYPENEIIKTTPNTGERVERGDSVDVVISKGPEKVKMPNVIGLPKEEALQKLKSLGLKDVTIEKVYNNQAPKGYIANQSVTANTEIAIHDSNIKLYESLGIKQVYVEDFEHKSFSKAKKALEEKGFKVESKEEYSDDIDEGDVISQSPKGKSVDEGSTISFVVSKG
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Transferase
|
molecule keywords |
Protein kinase
|
publication title |
The Extended Conformation of the 2.9-A Crystal Structure of the Three-PASTA Domain of a Ser/Thr Kinase from the Human Pathogen Staphylococcus aureus
pubmed doi rcsb |
source organism |
Staphylococcus aureus
|
total genus |
41
|
structure length |
201
|
sequence length |
201
|
ec nomenclature |
ec
2.7.11.1: Non-specific serine/threonine protein kinase. |
pdb deposition date | 2010-03-22 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF03793 | PASTA | PASTA domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 2-Layer Sandwich | Trypsin Inhibitor V; Chain A | Trypsin Inhibitor V; Chain A | ||
Alpha Beta | 2-Layer Sandwich | Trypsin Inhibitor V; Chain A | Trypsin Inhibitor V; Chain A | ||
Alpha Beta | 2-Layer Sandwich | Trypsin Inhibitor V; Chain A | Trypsin Inhibitor V; Chain A |
#chains in the Genus database with same CATH superfamily 2KUF A; 3PY9 A; 2KUE A; 5E10 A; 3OUV A; 2KUI A; 2MGV A; 3M9G A; 2KUD A; 5E0Y A; 5E0Z A; #chains in the Genus database with same CATH topology 2KUF A; 1TM1 I; 1Y3F I; 5E10 A; 2TEC I; 2KUI A; 1COA I; 1TO1 I; 1Y4D I; 1Y1K I; 2CI2 I; 5FFN I; 5E0Z A; 3W0E A; 5FBZ B; 1DWM A; 2KUE A; 1YPC I; 1Y3B I; 1Y48 I; 4B2A B; 1VBW A; 1TM4 I; 1Y3D I; 1CIS A; 1TM7 I; 4B2C B; 1ACB I; 3CI2 A; 3PY9 A; 3RDY A; 4B2B B; 1Y3C I; 1TIN A; 1YPB I; 2SEC I; 2SNI I; 1LW6 I; 1Y4A I; 5E0Y A; 1YPA I; 4B1T B; 1MEE I; 2KUD A; 4H4F B; 3TEC I; 1TM3 I; 1EGL A; 1TM5 I; 1MIT A; 1SBN I; 1TEC I; 1Y33 I; 1Y34 I; 3W0D A; 3OUV A; 1TO2 I; 2MGV A; 1CSE I; 3M9G A; 1TMG I; 1HYM A; 3RDZ C; 1SIB I; #chains in the Genus database with same CATH homology 2KUF A; 3PY9 A; 2KUE A; 5E10 A; 3OUV A; 2KUI A; 2MGV A; 3M9G A; 2KUD A; 5E0Y A; 5E0Z A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...