The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
19
|
sequence length |
67
|
structure length |
67
|
Chain Sequence |
QCSGKQEWPELVGERGSKAAKIIENENEDVRAIVLPEGSAVPRDLRCDRVWVFVDERGVVVDTPVVM
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Hydrolase/hydrolase inhibitor
|
molecule keywords |
Cationic trypsin
|
publication title |
Conformational Changes of rBTI from Buckwheat upon Binding to Trypsin: Implications for the Role of the P(8)' Residue in the Potato Inhibitor I Family
pubmed doi rcsb |
source organism |
Fagopyrum esculentum
|
total genus |
19
|
structure length |
67
|
sequence length |
67
|
chains with identical sequence |
D
|
ec nomenclature | |
pdb deposition date | 2011-04-02 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
C | PF00280 | potato_inhibit | Potato inhibitor I family |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 2-Layer Sandwich | Trypsin Inhibitor V; Chain A | Trypsin Inhibitor V, subunit A |
#chains in the Genus database with same CATH superfamily 4B2A B; 1DWM A; 3CI2 A; 1SIB I; 1EGL A; 1TIN A; 1Y33 I; 3TEC I; 1SBN I; 1VBW A; 1Y3B I; 1Y34 I; 1Y48 I; 3W0E A; 4B1T B; 1Y4D I; 1LW6 I; 1YPC I; 1TM4 I; 3RDY A; 1TM5 I; 1TM3 I; 1TO2 I; 2SNI I; 1Y3F I; 1YPA I; 1TM1 I; 1HYM A; 5FFN I; 1TMG I; 1TO1 I; 1ACB I; 1YPB I; 1CIS A; 1COA I; 1Y1K I; 1TEC I; 4B2C B; 1CSE I; 1Y3D I; 4H4F B; 1Y4A I; 2SEC I; 3W0D A; 1MEE I; 1Y3C I; 2CI2 I; 5FBZ B; 1MIT A; 4B2B B; 3RDZ C; 2TEC I; 1TM7 I; #chains in the Genus database with same CATH topology 4B2A B; 1DWM A; 5E0Y A; 3CI2 A; 1SIB I; 3RDZ C; 1EGL A; 1TIN A; 2MGV A; 1Y33 I; 3OUV A; 3TEC I; 1SBN I; 1VBW A; 1Y3B I; 1Y34 I; 1Y48 I; 3W0E A; 4B1T B; 1Y4D I; 1LW6 I; 1YPC I; 1TM4 I; 3RDY A; 3M9G A; 1TM5 I; 1TM3 I; 1TO2 I; 2KUF A; 2SNI I; 1Y3F I; 1YPA I; 2KUI A; 1TM1 I; 1HYM A; 5FFN I; 1TMG I; 1TO1 I; 2KUD A; 5E0Z A; 1ACB I; 1YPB I; 1CIS A; 1COA I; 1Y1K I; 1TEC I; 4B2C B; 1CSE I; 1Y3D I; 4H4F B; 1Y4A I; 2SEC I; 3W0D A; 1MEE I; 1Y3C I; 2CI2 I; 5FBZ B; 1MIT A; 4B2B B; 2KUE A; 5E10 A; 2TEC I; 3PY9 A; 1TM7 I; #chains in the Genus database with same CATH homology 4B2A B; 1DWM A; 3CI2 A; 1SIB I; 1EGL A; 1TIN A; 1Y33 I; 3TEC I; 1SBN I; 1VBW A; 1Y3B I; 1Y34 I; 1Y48 I; 3W0E A; 4B1T B; 1Y4D I; 1LW6 I; 1YPC I; 1TM4 I; 3RDY A; 1TM5 I; 1TM3 I; 1TO2 I; 2SNI I; 1Y3F I; 1YPA I; 1TM1 I; 1HYM A; 5FFN I; 1TMG I; 1TO1 I; 1ACB I; 1YPB I; 1CIS A; 1COA I; 1Y1K I; 1TEC I; 4B2C B; 1CSE I; 1Y3D I; 4H4F B; 1Y4A I; 2SEC I; 3W0D A; 1MEE I; 1Y3C I; 2CI2 I; 5FBZ B; 1MIT A; 4B2B B; 3RDZ C; 2TEC I; 1TM7 I;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...