The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
62
|
sequence length |
219
|
structure length |
219
|
Chain Sequence |
VLPVEKCNLEDSACMTSAFQQALPTFVAGLPDHGVEVMDVLDLDDFAFDLSGLQFTLKEGKLKGLKGAVIDNVKWDLKKKNIEVDFHLDATVKGHYTAGGRILILPITGDGQMKLKLKNIHIHLVVSYEMEKDAEGVDHVIFKKYTVTFDVKDNAQFGLTNLFNGNKELSDTMLTFLNQNWKQVSEEFGKPVMEAAAKKIFKNIKHFLAKVPIAEIANV
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Transport protein
|
molecule keywords |
Takeout-like protein 1
|
publication title |
Crystal structure of Epiphyas postvittana takeout 1 with bound ubiquinone supports a role as ligand carriers for takeout proteins in insects
pubmed doi rcsb |
source organism |
Epiphyas postvittana
|
total genus |
62
|
structure length |
219
|
sequence length |
219
|
ec nomenclature | |
pdb deposition date | 2008-08-20 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | Super Roll | Bactericidal permeability-increasing protein; domain 1 | Bactericidal permeability-increasing protein; domain 1 |
#chains in the Genus database with same CATH superfamily 3E8T A; 4G0S A; 3A1Z A; 3AOT A; 2RCK A; 2RQF A; 3E8W A; 3AOS A; #chains in the Genus database with same CATH topology 4G0S A; 2RCK A; 2RQF A; 3E8W A; 4KGH A; 4F2A A; 3ZPM A; 3N72 A; 4KGO A; 3AOS A; 4M4D A; 4EWS A; 3E8T A; 5I7J A; 5I7L A; 3L6I A; 2OBD A; 1BP1 A; 3H4Z A; 1EWF A; 1USU B; 1USV B; 3A1Z A; 3AOT A; 3UV1 A; 5I7K A; #chains in the Genus database with same CATH homology 4G0S A; 2RCK A; 2RQF A; 3E8W A; 4KGH A; 4F2A A; 3ZPM A; 3N72 A; 4KGO A; 3AOS A; 4M4D A; 4EWS A; 3E8T A; 5I7J A; 5I7L A; 3L6I A; 2OBD A; 1BP1 A; 3H4Z A; 1EWF A; 1USU B; 1USV B; 3A1Z A; 3AOT A; 3UV1 A; 5I7K A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...