The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
80
|
sequence length |
350
|
structure length |
287
|
Chain Sequence |
AWEKGMEAARALMDKYHVDNDLKANFKLLPDQVEALAAVCKTWLNEEHRGLQLTFTSNKTFVTMMGRFLQAYLQSFAEVTYKHHEPTGCALWLHRCAEIEGELKCLHGSIMINKDARCCVHDAACPANQFSGKSCGMFFSEGAKAQVAFKQIKAFMQALYPNAQTGHGHLLMPLRCECNSPFLGRQLPKLTPFALSNAEDLDKSVLASVHHPALIVFQCCNPPNCDFKISAPDLLNALVMVRSLWSENFTELPRMVVPEFKWSTKHQYRNVSLPVAHSDARQNPFDF
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Alternative arrangements of the protein chain are possible for the adenovirus single-stranded DNA binding protein.
pubmed doi rcsb |
| molecule keywords |
ADENOVIRUS SINGLE-STRANDED DNA-BINDING PROTEIN
|
| molecule tags |
Dna binding protein
|
| total genus |
80
|
| structure length |
287
|
| sequence length |
350
|
| chains with identical sequence |
B
|
| ec nomenclature | |
| pdb deposition date | 1995-05-11 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF02236 | Viral_DNA_bi | Viral DNA-binding protein, all alpha domain |
| A | PF03728 | Viral_DNA_Zn_bi | Viral DNA-binding protein, zinc binding domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Orthogonal Bundle | Adenovirus Single-stranded Dna-binding Protein, domain 1 | Adenovirus DNA-binding, N-terminal domain | ||
| Alpha Beta | Alpha-Beta Complex | Adenovirus Single-stranded DNA-binding Protein; domain 2 | Adenovirus DNA-binding, C-terminal domain superfamily/Adenovirus DNA-binding, zinc binding domain |
#chains in the Genus database with same CATH superfamily 2WB0 X; 2WAZ X; 1ANV A; 1ADU A; 1ADV A; #chains in the Genus database with same CATH topology 1ZAT A; 2WB0 X; 2HKL A; 2WAZ X; 1ANV A; 1ADU A; 1ADV A; #chains in the Genus database with same CATH homology 2WB0 X; 2WAZ X; 1ANV A; 1ADU A; 1ADV A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...