The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
20
|
sequence length |
79
|
structure length |
79
|
Chain Sequence |
GVTKEIRIPTLEECDVCHGSGAKPGTQPQTCPTCHGSGQVQMRQGFFAVQQTCPHCQGRGTLIKDPCNKCHGHGRVERS
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Solution structure of the cysteine-rich domain of the Escherichia coli chaperone protein DnaJ.
pubmed doi rcsb |
| molecule tags |
Chaperone
|
| source organism |
Escherichia coli
|
| molecule keywords |
DNAJ PROTEIN
|
| total genus |
20
|
| structure length |
79
|
| sequence length |
79
|
| ec nomenclature | |
| pdb deposition date | 2000-05-03 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF00684 | DnaJ_CXXCXGXG | DnaJ central domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Ribbon | Chaperone, DNAj Protein; Chain A | Heat shock protein DnaJ, cysteine-rich domain |
#chains in the Genus database with same CATH superfamily 1EXK A; 1NLT A; 2CTT A; #chains in the Genus database with same CATH topology 3LCZ A; 2ZP8 E; 1EXK A; 3LD0 1; 2CTT A; 2ZP9 C; 1NLT A; 2KO8 A; 2BX9 A; #chains in the Genus database with same CATH homology 1EXK A; 1NLT A; 2CTT A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
