The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
4
|
sequence length |
45
|
structure length |
45
|
Chain Sequence |
MFIWTSGRTSSSYRHDEKRNIYQKIRDHDLLDKRKTVTALKAGED
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
NMR structure of the "ball-and-chain" domain of KCNMB2, the beta 2-subunit of large conductance Ca2+- and voltage-activated potassium channels.
pubmed doi rcsb |
| molecule keywords |
potassium large conductance calcium-activated channel, subfa
|
| molecule tags |
Metal transport, membrane protein
|
| total genus |
4
|
| structure length |
45
|
| sequence length |
45
|
| ec nomenclature | |
| pdb deposition date | 2001-07-27 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF09303 | KcnmB2_inactiv | KCNMB2, ball and chain domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Few Secondary Structures | Irregular | Cytochrome C Oxidase; Chain M | KCNMB2, ball/chain domain |
#chains in the Genus database with same CATH superfamily 1JO6 A; #chains in the Genus database with same CATH topology 5B3S M; 1V54 M; 5IY5 M; 3AG2 M; 1OCC M; 3AG1 M; 1OCR M; 3AG4 M; 2DYR M; 5B1B M; 3WG7 M; 3AG3 M; 3ABL M; 3X2Q M; 1V55 M; 2EIN M; 1OCZ M; 2DYS M; 2EIJ M; 2EIL M; 3ABM M; 2EIM M; 3ABK M; 2Y69 M; 1OCO M; 1JO6 A; 2EIK M; 3ASO M; 3ASN M; 2ZXW M; 5B1A M; 2OCC M; #chains in the Genus database with same CATH homology 1JO6 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...