1K733

Co-crystal structure of anisomycin bound to the 50s ribosomal subunit
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
48
structure length
46
Chain Sequence
GKKSKATKKRLAKLDNQNSRVPAWVMLKTDERNHKRRHWRRNDTDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S RRNA
total genus 9
structure length 46
sequence length 48
ec nomenclature
pdb deposition date 2001-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00832 Ribosomal_L39 Ribosomal L39 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1620.10 Mainly Alpha Orthogonal Bundle Atp Synthase Epsilon Chain; Chain: I; Ribosomal protein L39e 1k73300
1VQ42 1VQ82 1YI22 3CCL2 2QA42 3CCS2 1VQ92 1M903 1KQS1 1QVF1 1VQM2 1YIT2 1K8A3 1K9M3 2QEX2 1VQN2 1VQ52 3G4S2 3CMA2 3CD62 2OTJ2 1N8R3 1VQL2 1K733 3CCE2 1S722 1KC83 3I562 1QVG1 3CME2 3CCV2 3CCJ2 1W2B1 1VQ72 1VQO2 1Q7Y3 1NJI3 1YHQ2 2OTL2 3G712 1VQP2 1Q863 3G6E2 1VQ62 1Q823 3CC72 1Q813 3OW21 3CC42 1KD13 1YIJ2 3I552 3CCU2 1YJN2 1M1K3 3CCM2 1JJ21 3CXC1 1YJ92 1VQK2 3CPW1 1YJW2 3CC22 3CCQ2 3CCR2
chains in the Genus database with same CATH superfamily
2WSSI 1E79I 1VQ42 1VQ82 1YI22 3CCL2 2QA42 3ZIAI 3CCS2 1VQ92 1M903 1KQS1 1QVF1 1VQM2 1YIT2 1K8A3 1K9M3 2QEX2 1VQN2 1VQ52 3G4S2 3CMA2 3CD62 2OTJ2 1N8R3 1VQL2 1K733 2V7QI 3CCE2 3OFNI 1S722 1KC83 3I562 1QVG1 3CME2 3CCV2 3CCJ2 2XOKI 1W2B1 1VQ72 1VQO2 1Q7Y3 1NJI3 1YHQ2 2OTL2 3G712 1VQP2 4YXWI 3G6E2 1Q863 1VQ62 1Q823 3CC72 1Q813 3OW21 3CC42 1KD13 1YIJ2 3I552 3CCU2 1YJN2 1M1K3 2WPDI 3CCM2 1JJ21 3CXC1 1YJ92 1VQK2 3CPW1 2XNDI 1YJW2 3CC22 3CCQ2 3CCR2
chains in the Genus database with same CATH topology
1VQ42 1VQ82 1YI22 3CCL2 2QA42 3CCS2 1VQ92 1M903 1KQS1 1QVF1 1VQM2 1YIT2 1K8A3 1K9M3 2QEX2 1VQN2 1VQ52 3G4S2 3CMA2 3CD62 2OTJ2 1N8R3 1VQL2 1K733 3CCE2 1S722 1KC83 3I562 1QVG1 3CME2 3CCV2 3CCJ2 1W2B1 1VQ72 1VQO2 1Q7Y3 1NJI3 1YHQ2 2OTL2 3G712 1VQP2 1Q863 3G6E2 1VQ62 1Q823 3CC72 1Q813 3OW21 3CC42 1KD13 1YIJ2 3I552 3CCU2 1YJN2 1M1K3 3CCM2 1JJ21 3CXC1 1YJ92 1VQK2 3CPW1 1YJW2 3CC22 3CCQ2 3CCR2
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ4 2;  1VQ8 2;  1YI2 2;  3CCL 2;  2QA4 2;  3CCS 2;  1VQ9 2;  1M90 3;  1KQS 1;  1QVF 1;  1VQM 2;  1YIT 2;  1K8A 3;  1K9M 3;  2QEX 2;  1VQN 2;  1VQ5 2;  3G4S 2;  3CMA 2;  3CD6 2;  2OTJ 2;  1N8R 3;  1VQL 2;  1K73 3;  3CCE 2;  1S72 2;  1KC8 3;  3I56 2;  1QVG 1;  3CME 2;  3CCV 2;  3CCJ 2;  1W2B 1;  1VQ7 2;  1VQO 2;  1Q7Y 3;  1NJI 3;  1YHQ 2;  2OTL 2;  3G71 2;  1VQP 2;  1Q86 3;  3G6E 2;  1VQ6 2;  1Q82 3;  3CC7 2;  1Q81 3;  3OW2 1;  3CC4 2;  1KD1 3;  1YIJ 2;  3I55 2;  3CCU 2;  1YJN 2;  1M1K 3;  3CCM 2;  1JJ2 1;  3CXC 1;  1YJ9 2;  1VQK 2;  3CPW 1;  1YJW 2;  3CC2 2;  3CCQ 2;  3CCR 2; 
#chains in the Genus database with same CATH topology
 2WSS I;  1E79 I;  1VQ4 2;  1VQ8 2;  1YI2 2;  3CCL 2;  2QA4 2;  3ZIA I;  3CCS 2;  1VQ9 2;  1M90 3;  1KQS 1;  1QVF 1;  1VQM 2;  1YIT 2;  1K8A 3;  1K9M 3;  2QEX 2;  1VQN 2;  1VQ5 2;  3G4S 2;  3CMA 2;  3CD6 2;  2OTJ 2;  1N8R 3;  1VQL 2;  1K73 3;  2V7Q I;  3CCE 2;  3OFN I;  1S72 2;  1KC8 3;  3I56 2;  1QVG 1;  3CME 2;  3CCV 2;  3CCJ 2;  2XOK I;  1W2B 1;  1VQ7 2;  1VQO 2;  1Q7Y 3;  1NJI 3;  1YHQ 2;  2OTL 2;  3G71 2;  1VQP 2;  4YXW I;  3G6E 2;  1Q86 3;  1VQ6 2;  1Q82 3;  3CC7 2;  1Q81 3;  3OW2 1;  3CC4 2;  1KD1 3;  1YIJ 2;  3I55 2;  3CCU 2;  1YJN 2;  1M1K 3;  2WPD I;  3CCM 2;  1JJ2 1;  3CXC 1;  1YJ9 2;  1VQK 2;  3CPW 1;  2XND I;  1YJW 2;  3CC2 2;  3CCQ 2;  3CCR 2; 
#chains in the Genus database with same CATH homology
 1VQ4 2;  1VQ8 2;  1YI2 2;  3CCL 2;  2QA4 2;  3CCS 2;  1VQ9 2;  1M90 3;  1KQS 1;  1QVF 1;  1VQM 2;  1YIT 2;  1K8A 3;  1K9M 3;  2QEX 2;  1VQN 2;  1VQ5 2;  3G4S 2;  3CMA 2;  3CD6 2;  2OTJ 2;  1N8R 3;  1VQL 2;  1K73 3;  3CCE 2;  1S72 2;  1KC8 3;  3I56 2;  1QVG 1;  3CME 2;  3CCV 2;  3CCJ 2;  1W2B 1;  1VQ7 2;  1VQO 2;  1Q7Y 3;  1NJI 3;  1YHQ 2;  2OTL 2;  3G71 2;  1VQP 2;  1Q86 3;  3G6E 2;  1VQ6 2;  1Q82 3;  3CC7 2;  1Q81 3;  3OW2 1;  3CC4 2;  1KD1 3;  1YIJ 2;  3I55 2;  3CCU 2;  1YJN 2;  1M1K 3;  3CCM 2;  1JJ2 1;  3CXC 1;  1YJ9 2;  1VQK 2;  3CPW 1;  1YJW 2;  3CC2 2;  3CCQ 2;  3CCR 2; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...