The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
55
|
sequence length |
182
|
structure length |
177
|
Chain Sequence |
KHPLQNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQQRRSDLDRFWLETLLCLIGESFDDYSDDVCGAVVNVRAKGDKIAIWTTECENRDAVTHIGRVYKERLGLPPKIVIGYQSHADTATKKNRFVV
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Biophysical studies of eIF4E cap-binding protein: recognition of mRNA 5' cap structure and synthetic fragments of eIF4G and 4E-BP1 proteins.
pubmed doi rcsb |
| molecule keywords |
EUKARYOTIC TRANSLATION INITIATION FACTOR 4E
|
| molecule tags |
Rna binding protein
|
| source organism |
Mus musculus
|
| total genus |
55
|
| structure length |
177
|
| sequence length |
182
|
| chains with identical sequence |
B
|
| ec nomenclature | |
| pdb deposition date | 2002-03-19 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF01652 | IF4E | Eukaryotic initiation factor 4E |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 2-Layer Sandwich | RNA Cap, Translation Initiation Factor Eif4e | RNA Cap, Translation Initiation Factor Eif4e |
#chains in the Genus database with same CATH superfamily 5EKV A; 1RF8 A; 2W97 A; 4TQB A; 4UEB A; 2IDR A; 4TQC A; 5ABV A; 4UE8 A; 3M93 A; 4UED A; 4UEC A; 2IDV A; 2JGC A; 4BEA A; 4B6V A; 4DT6 A; 2V8Y A; 1L8B A; 4UEA A; 1AP8 A; 5ABY A; 2WMC A; 2JGB A; 2V8X A; 1EJ1 A; 3AM7 A; 5EIR A; 4TPW A; 1WKW A; 1EJ4 A; 3HXI A; 2GPQ A; 5EHC A; 5T48 A; 3U7X A; 5ABU A; 5GW6 A; 1IPC A; 4UE9 A; 5T47 A; 4B6U A; 2W97 B; 3M94 A; 5T46 A; 5BXV A; 3TF2 A; 1ZTP A; 5EI3 A; 1IPB A; 2Q4K A; 3HXG A; 4AZA A; 4AXG A; 2V8W A; 1EJH A; 4DUM A; 5ABX A; #chains in the Genus database with same CATH topology 5EKV A; 1RF8 A; 2W97 A; 4TQB A; 4UEB A; 2IDR A; 4TQC A; 5ABV A; 4UE8 A; 3M93 A; 4UED A; 4UEC A; 2IDV A; 2JGC A; 4BEA A; 4B6V A; 4DT6 A; 2V8Y A; 1L8B A; 4UEA A; 1AP8 A; 5ABY A; 2WMC A; 2JGB A; 2V8X A; 1EJ1 A; 3AM7 A; 5EIR A; 4TPW A; 1WKW A; 1EJ4 A; 3HXI A; 2GPQ A; 5EHC A; 5T48 A; 3U7X A; 5ABU A; 5GW6 A; 1IPC A; 4UE9 A; 5T47 A; 4B6U A; 2W97 B; 3M94 A; 5T46 A; 5BXV A; 3TF2 A; 1ZTP A; 5EI3 A; 1IPB A; 2Q4K A; 3HXG A; 4AZA A; 4AXG A; 2V8W A; 1EJH A; 4DUM A; 5ABX A; #chains in the Genus database with same CATH homology 5EKV A; 1RF8 A; 2W97 A; 4TQB A; 4UEB A; 2IDR A; 4TQC A; 5ABV A; 4UE8 A; 3M93 A; 4UED A; 4UEC A; 2IDV A; 2JGC A; 4BEA A; 4B6V A; 4DT6 A; 2V8Y A; 1L8B A; 4UEA A; 1AP8 A; 5ABY A; 2WMC A; 2JGB A; 2V8X A; 1EJ1 A; 3AM7 A; 5EIR A; 4TPW A; 1WKW A; 1EJ4 A; 3HXI A; 2GPQ A; 5EHC A; 5T48 A; 3U7X A; 5ABU A; 5GW6 A; 1IPC A; 4UE9 A; 5T47 A; 4B6U A; 2W97 B; 3M94 A; 5T46 A; 5BXV A; 3TF2 A; 1ZTP A; 5EI3 A; 1IPB A; 2Q4K A; 3HXG A; 4AZA A; 4AXG A; 2V8W A; 1EJH A; 4DUM A; 5ABX A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...