1M3DA

Structure of type iv collagen nc1 domains
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
223
structure length
223
Chain Sequence
GFLVTRHSQTTDDPQCPPGTKILYHGYSLLYVQGNERAHGQDLGTAGSCLRKFSTMPFLFCNINNVCNFASRNDYSYWLSTPEPMPMSMAPITGENIRPFISRCAVCEAPAMVMAVHSQTIQIPQCPTGWSSLWIGYSFVMHTSAGAEGSGQALASPGSCLEEFRSAPFIECHGRGTCNYYANAYSFWLATIERSEMFKKPTPSTLKAGELRTHVSRCQVCMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of NC1 Domains. Structural Basis for Type IV Collagen Assembly in Basement Membranes
pubmed doi rcsb
molecule tags Structural protein
molecule keywords Type IV Collagen Noncollagenous Domain- Alpha1
total genus 50
structure length 223
sequence length 223
chains with identical sequence B, D, E, G, H, J, K
ec nomenclature
pdb deposition date 2002-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01413 C4 C-terminal tandem repeated domain in type 4 procollagen
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.240.10 Mainly Beta Beta Complex Noncollagenous (NC1) domain of collagen IV Collagen IV, non-collagenous 1m3dA00
1T60A 1M3DA 1T60C 1M3DC 1T61A 1LI1A 1LI1C 1T61C
chains in the Genus database with same CATH superfamily
1T60A 1M3DA 1T60C 1M3DC 1T61A 1LI1A 1LI1C 1T61C
chains in the Genus database with same CATH topology
1T60A 1M3DA 1T60C 1M3DC 1T61A 1LI1A 1LI1C 1T61C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T60 A;  1M3D A;  1T60 C;  1M3D C;  1T61 A;  1LI1 A;  1LI1 C;  1T61 C; 
#chains in the Genus database with same CATH topology
 1T60 A;  1M3D A;  1T60 C;  1M3D C;  1T61 A;  1LI1 A;  1LI1 C;  1T61 C; 
#chains in the Genus database with same CATH homology
 1T60 A;  1M3D A;  1T60 C;  1M3D C;  1T61 A;  1LI1 A;  1LI1 C;  1T61 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...