The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
22
|
sequence length |
111
|
structure length |
111
|
Chain Sequence |
SHMQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEILGFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIPSAFLELKKEEIKQR
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Structure and function of the PWI motif: a novel nucleic acid-binding domain that facilitates pre-mRNA processing.
pubmed doi rcsb |
| molecule tags |
Rna binding protein
|
| source organism |
Homo sapiens
|
| molecule keywords |
Ser/Arg-related nuclear matrix protein
|
| total genus |
22
|
| structure length |
111
|
| sequence length |
111
|
| ec nomenclature | |
| pdb deposition date | 2002-09-11 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF01480 | PWI | PWI domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Up-down Bundle | PWI domain | PWI domain |
#chains in the Genus database with same CATH superfamily 1X4Q A; 3V53 A; 1MP1 A; #chains in the Genus database with same CATH topology 1X4Q A; 2IWH A; 2IW3 A; 3V53 A; 1MP1 A; 2IX3 A; #chains in the Genus database with same CATH homology 1X4Q A; 2IWH A; 2IW3 A; 3V53 A; 1MP1 A; 2IX3 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
