The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
19
|
sequence length |
116
|
structure length |
116
|
Chain Sequence |
HMNGARKWFFPDGYIPNGKRGYLVSHESLCIMNTGDETAKIRITFLFEDSKPVVHEVEISPMKSLHLRLDKLGIPKCKPYSIMAESNVPVVMQLSRLDVGKNHYTLMTTIGYWEEG
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Crystal Structure Analysis of Thermotoga maritima Hypothetical protein TM1070
rcsb |
| molecule keywords |
hypothetical protein TM1070
|
| molecule tags |
Structural genomics, unknown function
|
| source organism |
Thermotoga maritima
|
| total genus |
19
|
| structure length |
116
|
| sequence length |
116
|
| chains with identical sequence |
B, C, D
|
| ec nomenclature | |
| pdb deposition date | 2002-12-04 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF07100 | ASRT | Anabaena sensory rhodopsin transducer |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Sandwich | Hypothetical Protein Tm1070; Chain: A | TM1070-like |
#chains in the Genus database with same CATH superfamily 2II8 A; 1NC7 A; 2IIA A; 2II7 A; 2II9 A; #chains in the Genus database with same CATH topology 2II8 A; 1NC7 A; 2IIA A; 2II7 A; 4H3W A; 2II9 A; #chains in the Genus database with same CATH homology 2II8 A; 1NC7 A; 2IIA A; 2II7 A; 2II9 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...