The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
15
|
sequence length |
52
|
structure length |
52
|
Chain Sequence |
NQGKIWTVVNPAIGIPALLGSVTVIAILVHLAILSHTTWFPAYWQGGVKKAA
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
The structure and thermal motion of the B800-850 LH2 complex from Rps. acidophila at 2.0 A resolution and 100K : new structural features and functionally relevant motions.
pubmed doi rcsb |
| molecule tags |
Membrane protein
|
| source organism |
Rhodoblastus acidophilus
|
| molecule keywords |
Light-harvesting protein B-800/850, alpha chain
|
| total genus |
15
|
| structure length |
52
|
| sequence length |
52
|
| chains with identical sequence |
C, E
|
| ec nomenclature | |
| pdb deposition date | 2003-01-06 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF00556 | LHC | Antenna complex alpha/beta subunit |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Few Secondary Structures | Irregular | Light-harvesting Protein | Light-harvesting complex |
#chains in the Genus database with same CATH superfamily 1LGH A; 1KZU A; 1XRD A; 1NKZ A; 1IJD A; 3WMM 1; 2FKW A; #chains in the Genus database with same CATH topology 1A92 A; 1LGH A; 1KZU A; 1XRD A; 1NKZ A; 1IJD A; 3WMM 1; 2FKW A; #chains in the Genus database with same CATH homology 1LGH A; 1KZU A; 1XRD A; 1NKZ A; 1IJD A; 3WMM 1; 2FKW A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
