The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
21
|
sequence length |
109
|
structure length |
109
|
Chain Sequence |
DNILYSGETLSPGEFLNNGRYVFIMQEDCNLVLYDVDKPIWATNTGGLDRRCHLSMQSDGNLVVYSPRNNPIWASNTGGENGNYVCVLQKDRNVVIYGTARWATGTNIH
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Insights into carbohydrate recognition by Narcissus pseudonarcissus lectin: the crystal structure at 2 A resolution in complex with alpha1-3 mannobiose.
pubmed doi rcsb |
| molecule keywords |
PROTEIN (AGGLUTININ)
|
| molecule tags |
Sugar binding protein
|
| total genus |
21
|
| structure length |
109
|
| sequence length |
109
|
| ec nomenclature | |
| pdb deposition date | 1998-12-17 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Orthogonal Prism | Agglutinin, subunit A | Bulb-type lectin domain |
#chains in the Genus database with same CATH superfamily 5D9Z A; 1BWU Q; 4GC2 A; 3M7H A; 4PDT A; 5D9Z B; 3R0E A; 4TKC A; 5T1X A; 1XD5 A; 5T1X B; 3R0E B; 1BWU A; 3MEZ A; 3A0C A; 3A0D A; 5T20 A; 3MEZ B; 5D5G A; 1NIV A; 1BWU P; 5T20 B; 5D5G B; 2DPF A; 1DLP A; 1MSA A; 4H3O A; 1KJ1 D; 1JPC A; 3M7J A; 3A0E A; 5J76 A; 5J76 B; 2D04 A; 1XD6 A; 1B2P A; 2D04 B; 3DZW A; 4GC1 A; 1BWU D; 1NPL A; 1KJ1 A; #chains in the Genus database with same CATH topology 5D9Z A; 1BWU Q; 4GC2 A; 3M7H A; 4PDT A; 5D9Z B; 4LEA A; 4LED A; 3R0E A; 4TKC A; 5T1X A; 1XD5 A; 5T1X B; 3R0E B; 1BWU A; 3MEZ A; 3A0C A; 3A0D A; 4LE7 A; 3MEZ B; 5D5G A; 5T20 A; 1NIV A; 1BWU P; 5T20 B; 5D5G B; 2DPF A; 1DLP A; 1MSA A; 4OIZ A; 4H3O A; 1KJ1 D; 1JPC A; 3M7J A; 3A0E A; 5J76 A; 5J76 B; 2D04 A; 1XD6 A; 1B2P A; 2D04 B; 3DZW A; 4OIT A; 4GC1 A; 1BWU D; 1NPL A; 4OKC A; 1KJ1 A; #chains in the Genus database with same CATH homology 5D9Z A; 1BWU Q; 4GC2 A; 3M7H A; 4PDT A; 5D9Z B; 3R0E A; 4TKC A; 5T1X A; 1XD5 A; 5T1X B; 3R0E B; 1BWU A; 3MEZ A; 3A0C A; 3A0D A; 5T20 A; 3MEZ B; 5D5G A; 1NIV A; 1BWU P; 5T20 B; 5D5G B; 2DPF A; 1DLP A; 1MSA A; 4H3O A; 1KJ1 D; 1JPC A; 3M7J A; 3A0E A; 5J76 A; 5J76 B; 2D04 A; 1XD6 A; 1B2P A; 2D04 B; 3DZW A; 4GC1 A; 1BWU D; 1NPL A; 1KJ1 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...