The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
34
|
sequence length |
198
|
structure length |
198
|
Chain Sequence |
RVVTQNEIDRTIPVGAIMMWAADSLPSDAWRFCHGGTVSASDCPLYASRIGTRYGGSSSNPGLPDMRGLFVRGSGRGSHLTNPNVNGNDQFGKPRLGVGCTGGYVGEVQKQQMSYHKHAGGFGEYDDSGAFGNTRRSNFVGTRKGLDWDNRSYFTNDGYEIDPASQRNSRYTLNRPELIGNETRPWNISLNYIIKVKE
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
The Structure of the Receptor-Binding Domain of the Bacteriophage T4 Short Tail Fibre Reveals a Knitted Trimeric Metal-Binding Fold
pubmed doi rcsb |
molecule tags |
Structural protein
|
source organism |
Bacteriophage t4
|
molecule keywords |
BACTERIOPHAGE T4 SHORT TAIL FIBRE
|
total genus |
34
|
structure length |
198
|
sequence length |
198
|
ec nomenclature | |
pdb deposition date | 2003-02-11 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF07484 | Collar | Phage Tail Collar Domain |
A | PF14928 | S_tail_recep_bd | Short tail fibre protein receptor-binding domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | Alpha-Beta Complex | heat- and protease-stable fragment of the bacteriophage t4 short fibre, domain 3 | Phage tail collar domain | ||
Few Secondary Structures | Irregular | receptor-binding domain of the bacteriophage t4 short tail fibre, domain 2 | receptor-binding domain of the bacteriophage t4 short tail fibre, domain 2 |
#chains in the Genus database with same CATH superfamily 1OCY A; 2XGF A; 1H6W A; #chains in the Genus database with same CATH topology 1OCY A; 2XGF A; 1H6W A; #chains in the Genus database with same CATH homology 1OCY A; 2XGF A; 1H6W A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...