The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
165
|
sequence length |
424
|
structure length |
424
|
Chain Sequence |
GNVVAILGAQWGDEGKGKIIDMLSEYSDITCRFNGGANAGHTISVNDKKYALHLLPCGVLYDNNISVLGNGMVIHVKSLMEEIESVGGKLLDRLYLSNKAHILFDIHQIIDSIQETKKLKEGKQIGTTKRGIGPCYSTKASRIGIRLGTLKNFENFKNMYSKLIDHLMDLYNITEYDKEKELNLFYNYHIKLRDRIVDVISFMNTNLENNKKVLIEGANAAMLDIDFGTYPYVTSSCTTVGGVFSGLGIHHKKLNLVVGVVKSYLTRVGCGPFLTELNNDVGQYLREKGHEYGTTTKRPRRCGWLDIPMLLYVKCINSIDMINLTKLDVLSGLEEILLCVNFKNKKTGELLEKGCYPVEEEISEEYEPVYEKFSGWKEDISTCNEFDELPENAKKYILAIEKYLKTPIVWIGVGPNRKNMIVKK
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Crystal Structure of Fully Ligated Adenylosuccinate Synthetase from Plasmodium falciparum.
pubmed doi rcsb |
| molecule keywords |
Adenylosuccinate Synthetase
|
| molecule tags |
Ligase
|
| source organism |
Plasmodium falciparum
|
| total genus |
165
|
| structure length |
424
|
| sequence length |
424
|
| ec nomenclature |
ec
6.3.4.4: Adenylosuccinate synthase. |
| pdb deposition date | 2003-05-10 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF00709 | Adenylsucc_synt | Adenylosuccinate synthetase |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Orthogonal Bundle | Adenylosuccinate Synthetase, subunit A; domain 2 | Adenylosuccinate Synthetase, subunit A, domain 2 | ||
| Alpha Beta | 3-Layer(aba) Sandwich | Adenylosuccinate Synthetase; Chain A, domain 1 | Adenylosuccinate Synthetase, subunit A, domain 1 | ||
| Alpha Beta | Alpha-Beta Complex | Adenylosuccinate Synthetase; Chain A, domain 3 | Adenylosuccinate Synthetase, subunit A, domain 3 |
#chains in the Genus database with same CATH superfamily 1KJX A; 1QF5 A; 1GIM A; 2V40 A; 1CIB A; 4M9D A; 1DJ2 A; 1KSZ A; 3R7T A; 2D7U A; 1KKF A; 1LON A; 1CH8 A; 1HOP A; 4M0G A; 1MF0 A; 1NHT A; 2DGN A; 1DJ3 A; 1IWE A; 1CG0 A; 3HID A; 1SOO A; 5I34 A; 1KKB A; 1ADI A; 1CG4 A; 2GCQ A; 1GIN A; 1ADE A; 1P9B A; 1JUY A; 1HOO A; 1LNY A; 1CG1 A; 1CG3 A; 1LOO A; 1MEZ A; 1HON A; 1MF1 A; 1J4B A; 1SON A; 3UE9 A; 1QF4 A; #chains in the Genus database with same CATH topology 1KJX A; 1QF5 A; 1GIM A; 2V40 A; 1CIB A; 4M9D A; 1DJ2 A; 1KSZ A; 3R7T A; 2D7U A; 1KKF A; 1LON A; 1CH8 A; 1HOP A; 4M0G A; 1MF0 A; 1NHT A; 2DGN A; 1DJ3 A; 1IWE A; 1CG0 A; 3HID A; 1SOO A; 5I34 A; 1KKB A; 1ADI A; 1CG4 A; 2GCQ A; 1GIN A; 1ADE A; 1P9B A; 1JUY A; 1HOO A; 1LNY A; 1CG1 A; 1CG3 A; 1LOO A; 1MEZ A; 1HON A; 1MF1 A; 1J4B A; 1SON A; 3UE9 A; 1QF4 A; #chains in the Genus database with same CATH homology 1KJX A; 1QF5 A; 1GIM A; 2V40 A; 1CIB A; 4M9D A; 1DJ2 A; 1KSZ A; 3R7T A; 2D7U A; 1KKF A; 1LON A; 1CH8 A; 1HOP A; 4M0G A; 1MF0 A; 1NHT A; 2DGN A; 1DJ3 A; 1IWE A; 1CG0 A; 3HID A; 1SOO A; 5I34 A; 1KKB A; 1ADI A; 1CG4 A; 2GCQ A; 1GIN A; 1ADE A; 1P9B A; 1JUY A; 1HOO A; 1LNY A; 1CG1 A; 1CG3 A; 1LOO A; 1MEZ A; 1HON A; 1MF1 A; 1J4B A; 1SON A; 3UE9 A; 1QF4 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...