1Q7Y3

Crystal structure of ccdap-puromycin bound at the peptidyl transferase center of the 50s ribosomal subunit
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
48
structure length
46
Chain Sequence
GKKSKATKKRLAKLDNQNSRVPAWVMLKTDERNHKRRHWRRNDTDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights Into Peptide Bond Formation
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 9
structure length 46
sequence length 48
ec nomenclature
pdb deposition date 2003-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00832 Ribosomal_L39 Ribosomal L39 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1620.10 Mainly Alpha Orthogonal Bundle Atp Synthase Epsilon Chain; Chain: I; Ribosomal protein L39e 1q7y300
1VQ52 1QVG1 3CD62 3CCV2 1VQN2 2QEX2 3I552 3G4S2 3CCS2 1KQS1 3CC22 3CMA2 1VQL2 2OTL2 3CC42 3CC72 1NJI3 1YJ92 1Q7Y3 1VQP2 3CCQ2 1YIT2 2OTJ2 1KC83 1M903 1VQ62 1VQK2 1VQ92 1YIJ2 1S722 3CCL2 3G712 3CCU2 1VQO2 1N8R3 3CCJ2 1Q813 1M1K3 1VQ42 1YHQ2 1K8A3 1K9M3 3CCR2 1JJ21 1VQ72 1YI22 3CPW1 1YJN2 1W2B1 1VQ82 1Q823 1Q863 3CCE2 1YJW2 1VQM2 1K733 1QVF1 2QA42 1KD13 3I562 3OW21 3CCM2 3CME2 3CXC1 3G6E2
chains in the Genus database with same CATH superfamily
1VQ52 1QVG1 3CD62 2WPDI 3CCV2 1VQN2 2QEX2 3I552 3G4S2 3CCS2 3OFNI 3CC22 3CMA2 1KQS1 1VQL2 2OTL2 3CC42 3CC72 1NJI3 2V7QI 1YJ92 1Q7Y3 1VQP2 3CCQ2 1YIT2 2OTJ2 1KC83 2XOKI 1M903 1VQ62 1VQK2 1VQ92 1YIJ2 1S722 3CCL2 3G712 3CCU2 1VQO2 1N8R3 3CCJ2 1Q813 1M1K3 1VQ42 1YHQ2 1K8A3 1K9M3 3CCR2 2WSSI 3ZIAI 2XNDI 1VQ72 1YI22 1JJ21 3CPW1 1YJN2 1W2B1 1VQ82 1Q823 1Q863 3CCE2 1YJW2 1VQM2 1K733 1QVF1 2QA42 4YXWI 1KD13 3I562 3OW21 1E79I 3CCM2 3CME2 3CXC1 3G6E2
chains in the Genus database with same CATH topology
1VQ52 1QVG1 3CD62 3CCV2 1VQN2 2QEX2 3I552 3G4S2 3CCS2 1KQS1 3CC22 3CMA2 1VQL2 2OTL2 3CC42 3CC72 1NJI3 1YJ92 1Q7Y3 1VQP2 3CCQ2 1YIT2 2OTJ2 1KC83 1M903 1VQ62 1VQK2 1VQ92 1YIJ2 1S722 3CCL2 3G712 3CCU2 1VQO2 1N8R3 3CCJ2 1Q813 1M1K3 1VQ42 1YHQ2 1K8A3 1K9M3 3CCR2 1JJ21 1VQ72 1YI22 3CPW1 1YJN2 1W2B1 1VQ82 1Q823 1Q863 3CCE2 1YJW2 1VQM2 1K733 1QVF1 2QA42 1KD13 3I562 3OW21 3CCM2 3CME2 3CXC1 3G6E2
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ5 2;  1QVG 1;  3CD6 2;  3CCV 2;  1VQN 2;  2QEX 2;  3I55 2;  3G4S 2;  3CCS 2;  1KQS 1;  3CC2 2;  3CMA 2;  1VQL 2;  2OTL 2;  3CC4 2;  3CC7 2;  1NJI 3;  1YJ9 2;  1Q7Y 3;  1VQP 2;  3CCQ 2;  1YIT 2;  2OTJ 2;  1KC8 3;  1M90 3;  1VQ6 2;  1VQK 2;  1VQ9 2;  1YIJ 2;  1S72 2;  3CCL 2;  3G71 2;  3CCU 2;  1VQO 2;  1N8R 3;  3CCJ 2;  1Q81 3;  1M1K 3;  1VQ4 2;  1YHQ 2;  1K8A 3;  1K9M 3;  3CCR 2;  1JJ2 1;  1VQ7 2;  1YI2 2;  3CPW 1;  1YJN 2;  1W2B 1;  1VQ8 2;  1Q82 3;  1Q86 3;  3CCE 2;  1YJW 2;  1VQM 2;  1K73 3;  1QVF 1;  2QA4 2;  1KD1 3;  3I56 2;  3OW2 1;  3CCM 2;  3CME 2;  3CXC 1;  3G6E 2; 
#chains in the Genus database with same CATH topology
 1VQ5 2;  1QVG 1;  3CD6 2;  2WPD I;  3CCV 2;  1VQN 2;  2QEX 2;  3I55 2;  3G4S 2;  3CCS 2;  3OFN I;  3CC2 2;  3CMA 2;  1KQS 1;  1VQL 2;  2OTL 2;  3CC4 2;  3CC7 2;  1NJI 3;  2V7Q I;  1YJ9 2;  1Q7Y 3;  1VQP 2;  3CCQ 2;  1YIT 2;  2OTJ 2;  1KC8 3;  2XOK I;  1M90 3;  1VQ6 2;  1VQK 2;  1VQ9 2;  1YIJ 2;  1S72 2;  3CCL 2;  3G71 2;  3CCU 2;  1VQO 2;  1N8R 3;  3CCJ 2;  1Q81 3;  1M1K 3;  1VQ4 2;  1YHQ 2;  1K8A 3;  1K9M 3;  3CCR 2;  2WSS I;  3ZIA I;  2XND I;  1VQ7 2;  1YI2 2;  1JJ2 1;  3CPW 1;  1YJN 2;  1W2B 1;  1VQ8 2;  1Q82 3;  1Q86 3;  3CCE 2;  1YJW 2;  1VQM 2;  1K73 3;  1QVF 1;  2QA4 2;  4YXW I;  1KD1 3;  3I56 2;  3OW2 1;  1E79 I;  3CCM 2;  3CME 2;  3CXC 1;  3G6E 2; 
#chains in the Genus database with same CATH homology
 1VQ5 2;  1QVG 1;  3CD6 2;  3CCV 2;  1VQN 2;  2QEX 2;  3I55 2;  3G4S 2;  3CCS 2;  1KQS 1;  3CC2 2;  3CMA 2;  1VQL 2;  2OTL 2;  3CC4 2;  3CC7 2;  1NJI 3;  1YJ9 2;  1Q7Y 3;  1VQP 2;  3CCQ 2;  1YIT 2;  2OTJ 2;  1KC8 3;  1M90 3;  1VQ6 2;  1VQK 2;  1VQ9 2;  1YIJ 2;  1S72 2;  3CCL 2;  3G71 2;  3CCU 2;  1VQO 2;  1N8R 3;  3CCJ 2;  1Q81 3;  1M1K 3;  1VQ4 2;  1YHQ 2;  1K8A 3;  1K9M 3;  3CCR 2;  1JJ2 1;  1VQ7 2;  1YI2 2;  3CPW 1;  1YJN 2;  1W2B 1;  1VQ8 2;  1Q82 3;  1Q86 3;  3CCE 2;  1YJW 2;  1VQM 2;  1K73 3;  1QVF 1;  2QA4 2;  1KD1 3;  3I56 2;  3OW2 1;  3CCM 2;  3CME 2;  3CXC 1;  3G6E 2; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...