1S722

Refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
49
structure length
46
Chain Sequence
GKKSKATKKRLAKLDNQNSRVPAWVMLKTDRRNHKRRHWRRNDTDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Roles of Ribosomal Proteins in the Structure, Assembly and Evolution of the Large Ribosomal Subunit
pubmed doi rcsb
molecule keywords 23S ribosomal RNA
molecule tags Ribosome
total genus 9
structure length 46
sequence length 49
ec nomenclature
pdb deposition date 2004-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00832 Ribosomal_L39 Ribosomal L39 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1620.10 Mainly Alpha Orthogonal Bundle Atp Synthase Epsilon Chain; Chain: I; Ribosomal protein L39e 1s72200
3CC72 1JJ21 3CCL2 2QEX2 3CCJ2 3CC22 1VQK2 1YHQ2 1M1K3 1S722 1VQN2 1VQP2 1YIJ2 1Q7Y3 3OW21 1VQ92 1VQ52 2OTJ2 3CXC1 3G6E2 1M903 1VQ42 1KC83 2QA42 3G712 3CC42 1VQL2 3I562 3CCR2 3CCU2 1VQ72 1YJN2 1YI22 1KQS1 3CD62 3CPW1 1VQ82 1Q823 1KD13 1Q863 1YIT2 1N8R3 1YJ92 1QVF1 1K733 3CME2 1QVG1 1VQO2 3CCS2 1VQM2 3G4S2 1W2B1 1YJW2 3CCQ2 3CMA2 3CCM2 1VQ62 2OTL2 1Q813 1K9M3 3CCV2 3I552 1NJI3 1K8A3 3CCE2
chains in the Genus database with same CATH superfamily
3CC72 1JJ21 3CCL2 2QEX2 2WPDI 3CC22 3CCJ2 1VQK2 4YXWI 1YHQ2 1M1K3 1S722 1VQN2 1VQP2 1YIJ2 1Q7Y3 1E79I 3OW21 1VQ92 1VQ52 2OTJ2 2WSSI 3CXC1 3G6E2 1M903 1VQ42 1KC83 2QA42 3G712 3CC42 1VQL2 3I562 3CCR2 3CCU2 1VQ72 1YJN2 1YI22 1KQS1 3CD62 3CPW1 1VQ82 1Q823 1KD13 1Q863 1YIT2 1N8R3 1YJ92 2XOKI 1K733 2XNDI 3CME2 1QVG1 1QVF1 1VQO2 3CCS2 1VQM2 3G4S2 1W2B1 1YJW2 2V7QI 3CMA2 3CCM2 3CCQ2 1VQ62 2OTL2 1Q813 3OFNI 1K9M3 3CCV2 3I552 1NJI3 3ZIAI 1K8A3 3CCE2
chains in the Genus database with same CATH topology
3CC72 1JJ21 3CCL2 2QEX2 3CCJ2 3CC22 1VQK2 1YHQ2 1M1K3 1S722 1VQN2 1VQP2 1YIJ2 1Q7Y3 3OW21 1VQ92 1VQ52 2OTJ2 3CXC1 3G6E2 1M903 1VQ42 1KC83 2QA42 3G712 3CC42 1VQL2 3I562 3CCR2 3CCU2 1VQ72 1YJN2 1YI22 1KQS1 3CD62 3CPW1 1VQ82 1Q823 1KD13 1Q863 1YIT2 1N8R3 1YJ92 1QVF1 1K733 3CME2 1QVG1 1VQO2 3CCS2 1VQM2 3G4S2 1W2B1 1YJW2 3CCQ2 3CMA2 3CCM2 1VQ62 2OTL2 1Q813 1K9M3 3CCV2 3I552 1NJI3 1K8A3 3CCE2
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CC7 2;  1JJ2 1;  3CCL 2;  2QEX 2;  3CCJ 2;  3CC2 2;  1VQK 2;  1YHQ 2;  1M1K 3;  1S72 2;  1VQN 2;  1VQP 2;  1YIJ 2;  1Q7Y 3;  3OW2 1;  1VQ9 2;  1VQ5 2;  2OTJ 2;  3CXC 1;  3G6E 2;  1M90 3;  1VQ4 2;  1KC8 3;  2QA4 2;  3G71 2;  3CC4 2;  1VQL 2;  3I56 2;  3CCR 2;  3CCU 2;  1VQ7 2;  1YJN 2;  1YI2 2;  1KQS 1;  3CD6 2;  3CPW 1;  1VQ8 2;  1Q82 3;  1KD1 3;  1Q86 3;  1YIT 2;  1N8R 3;  1YJ9 2;  1QVF 1;  1K73 3;  3CME 2;  1QVG 1;  1VQO 2;  3CCS 2;  1VQM 2;  3G4S 2;  1W2B 1;  1YJW 2;  3CCQ 2;  3CMA 2;  3CCM 2;  1VQ6 2;  2OTL 2;  1Q81 3;  1K9M 3;  3CCV 2;  3I55 2;  1NJI 3;  1K8A 3;  3CCE 2; 
#chains in the Genus database with same CATH topology
 3CC7 2;  1JJ2 1;  3CCL 2;  2QEX 2;  2WPD I;  3CC2 2;  3CCJ 2;  1VQK 2;  4YXW I;  1YHQ 2;  1M1K 3;  1S72 2;  1VQN 2;  1VQP 2;  1YIJ 2;  1Q7Y 3;  1E79 I;  3OW2 1;  1VQ9 2;  1VQ5 2;  2OTJ 2;  2WSS I;  3CXC 1;  3G6E 2;  1M90 3;  1VQ4 2;  1KC8 3;  2QA4 2;  3G71 2;  3CC4 2;  1VQL 2;  3I56 2;  3CCR 2;  3CCU 2;  1VQ7 2;  1YJN 2;  1YI2 2;  1KQS 1;  3CD6 2;  3CPW 1;  1VQ8 2;  1Q82 3;  1KD1 3;  1Q86 3;  1YIT 2;  1N8R 3;  1YJ9 2;  2XOK I;  1K73 3;  2XND I;  3CME 2;  1QVG 1;  1QVF 1;  1VQO 2;  3CCS 2;  1VQM 2;  3G4S 2;  1W2B 1;  1YJW 2;  2V7Q I;  3CMA 2;  3CCM 2;  3CCQ 2;  1VQ6 2;  2OTL 2;  1Q81 3;  3OFN I;  1K9M 3;  3CCV 2;  3I55 2;  1NJI 3;  3ZIA I;  1K8A 3;  3CCE 2; 
#chains in the Genus database with same CATH homology
 3CC7 2;  1JJ2 1;  3CCL 2;  2QEX 2;  3CCJ 2;  3CC2 2;  1VQK 2;  1YHQ 2;  1M1K 3;  1S72 2;  1VQN 2;  1VQP 2;  1YIJ 2;  1Q7Y 3;  3OW2 1;  1VQ9 2;  1VQ5 2;  2OTJ 2;  3CXC 1;  3G6E 2;  1M90 3;  1VQ4 2;  1KC8 3;  2QA4 2;  3G71 2;  3CC4 2;  1VQL 2;  3I56 2;  3CCR 2;  3CCU 2;  1VQ7 2;  1YJN 2;  1YI2 2;  1KQS 1;  3CD6 2;  3CPW 1;  1VQ8 2;  1Q82 3;  1KD1 3;  1Q86 3;  1YIT 2;  1N8R 3;  1YJ9 2;  1QVF 1;  1K73 3;  3CME 2;  1QVG 1;  1VQO 2;  3CCS 2;  1VQM 2;  3G4S 2;  1W2B 1;  1YJW 2;  3CCQ 2;  3CMA 2;  3CCM 2;  1VQ6 2;  2OTL 2;  1Q81 3;  1K9M 3;  3CCV 2;  3I55 2;  1NJI 3;  1K8A 3;  3CCE 2; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...