The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
49
|
sequence length |
223
|
structure length |
223
|
Chain Sequence |
GFLVTRHSQTTDDPQCPPGTKILYHGYSLLYVQGNERAHGQDLGTAGSCLRKFSTMPFLFCNINNVCNFASRNDYSYWLSTPEPMPMSMAPITGENIRPFISRCAVCEAPAMVMAVHSQTIQIPQCPTGWSSLWIGYSFVMHTSAGAEGSGQALASPGSCLEEFRSAPFIECHGRGTCNYYANAYSFWLATIERSEMFKKPTPSTLKAGELRTHVSRCQVCMR
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
The alpha1.alpha2 network of collagen IV. Reinforced stabilization of the noncollagenous domain-1 by noncovalent forces and the absence of Met-Lys cross-links
pubmed doi rcsb |
| molecule tags |
Structural protein
|
| molecule keywords |
type iv collagen
|
| total genus |
49
|
| structure length |
223
|
| sequence length |
223
|
| chains with identical sequence |
B, D, E, G, H, J, K, M, N, P, Q, S, T, V, W
|
| ec nomenclature | |
| pdb deposition date | 2004-05-05 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF01413 | C4 | C-terminal tandem repeated domain in type 4 procollagen |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Beta Complex | Noncollagenous (NC1) domain of collagen IV | Collagen IV, non-collagenous |
#chains in the Genus database with same CATH superfamily 1LI1 A; 1T61 C; 1T60 C; 1LI1 C; 1M3D A; 1T61 A; 1T60 A; 1M3D C; #chains in the Genus database with same CATH topology 1LI1 A; 1T61 C; 1T60 C; 1LI1 C; 1M3D A; 1T61 A; 1T60 A; 1M3D C; #chains in the Genus database with same CATH homology 1LI1 A; 1T61 C; 1T60 C; 1LI1 C; 1M3D A; 1T61 A; 1T60 A; 1M3D C;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
