1VQ72

The structure of the transition state analogue "dca" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
49
structure length
46
Chain Sequence
GKKSKATKKRLAKLDNQNSRVPAWVMLKTDRRNHKRRHWRRNDTDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An induced-fit mechanism to promote peptide bond formation and exclude hydrolysis of peptidyl-tRNA.
pubmed doi rcsb
molecule keywords 23S ribosomal rna
molecule tags Ribosome
total genus 8
structure length 46
sequence length 49
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00832 Ribosomal_L39 Ribosomal L39 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1620.10 Mainly Alpha Orthogonal Bundle Atp Synthase Epsilon Chain; Chain: I; Ribosomal protein L39e 1vq7200
1Q823 1YJN2 1W2B1 3CME2 1QVG1 1VQ72 2OTL2 1Q863 3G6E2 3G712 1Q813 3CCU2 1VQK2 3CCJ2 3OW21 1YIT2 1YIJ2 1S722 1Q7Y3 1M1K3 1QVF1 1VQ92 3CXC1 1K733 1VQM2 3CD62 3CCE2 1VQ82 1YI22 3I552 1VQO2 1VQ52 1M903 1YHQ2 1JJ21 1VQL2 3CC22 3CCR2 1K9M3 1VQ62 1KD13 3I562 3CCS2 3CCL2 3CCQ2 1VQP2 3CMA2 3CC72 3CCM2 1KQS1 1VQ42 2QA42 2OTJ2 3CC42 3CCV2 1NJI3 1N8R3 1VQN2 3CPW1 1K8A3 1KC83 1YJ92 2QEX2 1YJW2 3G4S2
chains in the Genus database with same CATH superfamily
1Q823 1YJN2 1W2B1 3CME2 1QVG1 1VQ72 3OFNI 1Q863 3G6E2 3G712 1Q813 2OTL2 2WSSI 3CCU2 1VQK2 3CCJ2 3OW21 1YIT2 1YIJ2 1S722 1Q7Y3 1M1K3 1QVF1 4YXWI 3CXC1 1VQ92 1K733 1VQM2 3CD62 1E79I 3CCE2 1YI22 3I552 1VQ82 1VQO2 1VQ52 1M903 1YHQ2 1JJ21 1VQL2 3CC22 3CCR2 1K9M3 1VQ62 1KD13 3I562 3CCS2 2XOKI 3CCL2 3CCQ2 1VQP2 3CMA2 3CC72 3CCM2 1KQS1 2V7QI 2QA42 1VQ42 2OTJ2 3CC42 3CCV2 1NJI3 1N8R3 1VQN2 3ZIAI 3CPW1 1KC83 1K8A3 1YJ92 2QEX2 1YJW2 2WPDI 2XNDI 3G4S2
chains in the Genus database with same CATH topology
1Q823 1YJN2 1W2B1 3CME2 1QVG1 1VQ72 2OTL2 1Q863 3G6E2 3G712 1Q813 3CCU2 1VQK2 3CCJ2 3OW21 1YIT2 1YIJ2 1S722 1Q7Y3 1M1K3 1QVF1 1VQ92 3CXC1 1K733 1VQM2 3CD62 3CCE2 1VQ82 1YI22 3I552 1VQO2 1VQ52 1M903 1YHQ2 1JJ21 1VQL2 3CC22 3CCR2 1K9M3 1VQ62 1KD13 3I562 3CCS2 3CCL2 3CCQ2 1VQP2 3CMA2 3CC72 3CCM2 1KQS1 1VQ42 2QA42 2OTJ2 3CC42 3CCV2 1NJI3 1N8R3 1VQN2 3CPW1 1K8A3 1KC83 1YJ92 2QEX2 1YJW2 3G4S2
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q82 3;  1YJN 2;  1W2B 1;  3CME 2;  1QVG 1;  1VQ7 2;  2OTL 2;  1Q86 3;  3G6E 2;  3G71 2;  1Q81 3;  3CCU 2;  1VQK 2;  3CCJ 2;  3OW2 1;  1YIT 2;  1YIJ 2;  1S72 2;  1Q7Y 3;  1M1K 3;  1QVF 1;  1VQ9 2;  3CXC 1;  1K73 3;  1VQM 2;  3CD6 2;  3CCE 2;  1VQ8 2;  1YI2 2;  3I55 2;  1VQO 2;  1VQ5 2;  1M90 3;  1YHQ 2;  1JJ2 1;  1VQL 2;  3CC2 2;  3CCR 2;  1K9M 3;  1VQ6 2;  1KD1 3;  3I56 2;  3CCS 2;  3CCL 2;  3CCQ 2;  1VQP 2;  3CMA 2;  3CC7 2;  3CCM 2;  1KQS 1;  1VQ4 2;  2QA4 2;  2OTJ 2;  3CC4 2;  3CCV 2;  1NJI 3;  1N8R 3;  1VQN 2;  3CPW 1;  1K8A 3;  1KC8 3;  1YJ9 2;  2QEX 2;  1YJW 2;  3G4S 2; 
#chains in the Genus database with same CATH topology
 1Q82 3;  1YJN 2;  1W2B 1;  3CME 2;  1QVG 1;  1VQ7 2;  3OFN I;  1Q86 3;  3G6E 2;  3G71 2;  1Q81 3;  2OTL 2;  2WSS I;  3CCU 2;  1VQK 2;  3CCJ 2;  3OW2 1;  1YIT 2;  1YIJ 2;  1S72 2;  1Q7Y 3;  1M1K 3;  1QVF 1;  4YXW I;  3CXC 1;  1VQ9 2;  1K73 3;  1VQM 2;  3CD6 2;  1E79 I;  3CCE 2;  1YI2 2;  3I55 2;  1VQ8 2;  1VQO 2;  1VQ5 2;  1M90 3;  1YHQ 2;  1JJ2 1;  1VQL 2;  3CC2 2;  3CCR 2;  1K9M 3;  1VQ6 2;  1KD1 3;  3I56 2;  3CCS 2;  2XOK I;  3CCL 2;  3CCQ 2;  1VQP 2;  3CMA 2;  3CC7 2;  3CCM 2;  1KQS 1;  2V7Q I;  2QA4 2;  1VQ4 2;  2OTJ 2;  3CC4 2;  3CCV 2;  1NJI 3;  1N8R 3;  1VQN 2;  3ZIA I;  3CPW 1;  1KC8 3;  1K8A 3;  1YJ9 2;  2QEX 2;  1YJW 2;  2WPD I;  2XND I;  3G4S 2; 
#chains in the Genus database with same CATH homology
 1Q82 3;  1YJN 2;  1W2B 1;  3CME 2;  1QVG 1;  1VQ7 2;  2OTL 2;  1Q86 3;  3G6E 2;  3G71 2;  1Q81 3;  3CCU 2;  1VQK 2;  3CCJ 2;  3OW2 1;  1YIT 2;  1YIJ 2;  1S72 2;  1Q7Y 3;  1M1K 3;  1QVF 1;  1VQ9 2;  3CXC 1;  1K73 3;  1VQM 2;  3CD6 2;  3CCE 2;  1VQ8 2;  1YI2 2;  3I55 2;  1VQO 2;  1VQ5 2;  1M90 3;  1YHQ 2;  1JJ2 1;  1VQL 2;  3CC2 2;  3CCR 2;  1K9M 3;  1VQ6 2;  1KD1 3;  3I56 2;  3CCS 2;  3CCL 2;  3CCQ 2;  1VQP 2;  3CMA 2;  3CC7 2;  3CCM 2;  1KQS 1;  1VQ4 2;  2QA4 2;  2OTJ 2;  3CC4 2;  3CCV 2;  1NJI 3;  1N8R 3;  1VQN 2;  3CPW 1;  1K8A 3;  1KC8 3;  1YJ9 2;  2QEX 2;  1YJW 2;  3G4S 2; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...