1VQ92

The structure of cca-phe-cap-bio and the antibiotic sparsomycin bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
49
structure length
46
Chain Sequence
GKKSKATKKRLAKLDNQNSRVPAWVMLKTDRRNHKRRHWRRNDTDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 11
structure length 46
sequence length 49
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00832 Ribosomal_L39 Ribosomal L39 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1620.10 Mainly Alpha Orthogonal Bundle Atp Synthase Epsilon Chain; Chain: I; Ribosomal protein L39e 1vq9200
2QA42 3CC72 1VQ72 3OW21 2OTJ2 1VQO2 3CCL2 1QVG1 1Q7Y3 1N8R3 1S722 1KC83 1VQ62 3CCQ2 1VQK2 3CC42 3CCM2 1VQN2 1YHQ2 3I562 1YI22 1VQ92 1KQS1 3CC22 1YJW2 1NJI3 3CCU2 3CMA2 1YIT2 1YIJ2 3CCV2 2QEX2 3CME2 1Q823 1K9M3 2OTL2 1VQM2 1K8A3 1M903 3I552 3CPW1 1VQ82 3CXC1 1VQP2 1VQL2 3G712 1W2B1 1YJN2 3G6E2 1Q813 1VQ42 1YJ92 1QVF1 3G4S2 1M1K3 1JJ21 3CCS2 3CCE2 1K733 3CD62 3CCJ2 1KD13 1Q863 3CCR2 1VQ52
chains in the Genus database with same CATH superfamily
2QA42 3CC72 1VQ72 3OW21 2V7QI 1VQO2 3CCL2 1QVG1 2OTJ2 1Q7Y3 1N8R3 1S722 1KC83 3ZIAI 1VQ62 3CCQ2 1VQK2 2XOKI 3CC42 3CCM2 1VQN2 2XNDI 1YHQ2 3I562 1YI22 1VQ92 1KQS1 3CC22 1YJW2 1NJI3 3CCU2 3CMA2 3OFNI 1YIT2 4YXWI 1YIJ2 3CCV2 2QEX2 3CME2 2WPDI 1Q823 1K9M3 2OTL2 1VQM2 1K8A3 1M903 3I552 3CPW1 1VQ82 3CXC1 1VQP2 1VQL2 3G712 1W2B1 1YJN2 3G6E2 1Q813 1VQ42 1YJ92 1QVF1 3G4S2 1M1K3 1JJ21 3CCS2 2WSSI 3CCE2 1K733 1E79I 3CCJ2 1KD13 1Q863 3CCR2 3CD62 1VQ52
chains in the Genus database with same CATH topology
2QA42 3CC72 1VQ72 3OW21 2OTJ2 1VQO2 3CCL2 1QVG1 1Q7Y3 1N8R3 1S722 1KC83 1VQ62 3CCQ2 1VQK2 3CC42 3CCM2 1VQN2 1YHQ2 3I562 1YI22 1VQ92 1KQS1 3CC22 1YJW2 1NJI3 3CCU2 3CMA2 1YIT2 1YIJ2 3CCV2 2QEX2 3CME2 1Q823 1K9M3 2OTL2 1VQM2 1K8A3 1M903 3I552 3CPW1 1VQ82 3CXC1 1VQP2 1VQL2 3G712 1W2B1 1YJN2 3G6E2 1Q813 1VQ42 1YJ92 1QVF1 3G4S2 1M1K3 1JJ21 3CCS2 3CCE2 1K733 3CD62 3CCJ2 1KD13 1Q863 3CCR2 1VQ52
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QA4 2;  3CC7 2;  1VQ7 2;  3OW2 1;  2OTJ 2;  1VQO 2;  3CCL 2;  1QVG 1;  1Q7Y 3;  1N8R 3;  1S72 2;  1KC8 3;  1VQ6 2;  3CCQ 2;  1VQK 2;  3CC4 2;  3CCM 2;  1VQN 2;  1YHQ 2;  3I56 2;  1YI2 2;  1VQ9 2;  1KQS 1;  3CC2 2;  1YJW 2;  1NJI 3;  3CCU 2;  3CMA 2;  1YIT 2;  1YIJ 2;  3CCV 2;  2QEX 2;  3CME 2;  1Q82 3;  1K9M 3;  2OTL 2;  1VQM 2;  1K8A 3;  1M90 3;  3I55 2;  3CPW 1;  1VQ8 2;  3CXC 1;  1VQP 2;  1VQL 2;  3G71 2;  1W2B 1;  1YJN 2;  3G6E 2;  1Q81 3;  1VQ4 2;  1YJ9 2;  1QVF 1;  3G4S 2;  1M1K 3;  1JJ2 1;  3CCS 2;  3CCE 2;  1K73 3;  3CD6 2;  3CCJ 2;  1KD1 3;  1Q86 3;  3CCR 2;  1VQ5 2; 
#chains in the Genus database with same CATH topology
 2QA4 2;  3CC7 2;  1VQ7 2;  3OW2 1;  2V7Q I;  1VQO 2;  3CCL 2;  1QVG 1;  2OTJ 2;  1Q7Y 3;  1N8R 3;  1S72 2;  1KC8 3;  3ZIA I;  1VQ6 2;  3CCQ 2;  1VQK 2;  2XOK I;  3CC4 2;  3CCM 2;  1VQN 2;  2XND I;  1YHQ 2;  3I56 2;  1YI2 2;  1VQ9 2;  1KQS 1;  3CC2 2;  1YJW 2;  1NJI 3;  3CCU 2;  3CMA 2;  3OFN I;  1YIT 2;  4YXW I;  1YIJ 2;  3CCV 2;  2QEX 2;  3CME 2;  2WPD I;  1Q82 3;  1K9M 3;  2OTL 2;  1VQM 2;  1K8A 3;  1M90 3;  3I55 2;  3CPW 1;  1VQ8 2;  3CXC 1;  1VQP 2;  1VQL 2;  3G71 2;  1W2B 1;  1YJN 2;  3G6E 2;  1Q81 3;  1VQ4 2;  1YJ9 2;  1QVF 1;  3G4S 2;  1M1K 3;  1JJ2 1;  3CCS 2;  2WSS I;  3CCE 2;  1K73 3;  1E79 I;  3CCJ 2;  1KD1 3;  1Q86 3;  3CCR 2;  3CD6 2;  1VQ5 2; 
#chains in the Genus database with same CATH homology
 2QA4 2;  3CC7 2;  1VQ7 2;  3OW2 1;  2OTJ 2;  1VQO 2;  3CCL 2;  1QVG 1;  1Q7Y 3;  1N8R 3;  1S72 2;  1KC8 3;  1VQ6 2;  3CCQ 2;  1VQK 2;  3CC4 2;  3CCM 2;  1VQN 2;  1YHQ 2;  3I56 2;  1YI2 2;  1VQ9 2;  1KQS 1;  3CC2 2;  1YJW 2;  1NJI 3;  3CCU 2;  3CMA 2;  1YIT 2;  1YIJ 2;  3CCV 2;  2QEX 2;  3CME 2;  1Q82 3;  1K9M 3;  2OTL 2;  1VQM 2;  1K8A 3;  1M90 3;  3I55 2;  3CPW 1;  1VQ8 2;  3CXC 1;  1VQP 2;  1VQL 2;  3G71 2;  1W2B 1;  1YJN 2;  3G6E 2;  1Q81 3;  1VQ4 2;  1YJ9 2;  1QVF 1;  3G4S 2;  1M1K 3;  1JJ2 1;  3CCS 2;  3CCE 2;  1K73 3;  3CD6 2;  3CCJ 2;  1KD1 3;  1Q86 3;  3CCR 2;  1VQ5 2; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...