1VQP2

The structure of the transition state analogue "rap" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
49
structure length
46
Chain Sequence
GKKSKATKKRLAKLDNQNSRVPAWVMLKTDRRNHKRRHWRRNDTDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule keywords 23S ribosomal rna
molecule tags Ribosome
total genus 9
structure length 46
sequence length 49
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00832 Ribosomal_L39 Ribosomal L39 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1620.10 Mainly Alpha Orthogonal Bundle Atp Synthase Epsilon Chain; Chain: I; Ribosomal protein L39e 1vqp200
3CPW1 3CCL2 2OTJ2 1K9M3 3CMA2 3CC72 3CCU2 1YHQ2 1KC83 1VQ82 1VQL2 3CC42 3CME2 3CCE2 3CCM2 3CC22 3CCJ2 3CCS2 2OTL2 1VQ62 3CD62 1VQ42 1JJ21 1VQ72 1VQO2 1VQK2 1S722 1N8R3 3I552 2QA42 1YJN2 1YIT2 1YJW2 1K8A3 1M1K3 3G6E2 1VQP2 1QVG1 3G712 1W2B1 3CCR2 3CCQ2 1YI22 1Q813 1NJI3 3I562 3CXC1 1VQ92 1KD13 1Q863 1Q823 1YIJ2 3OW21 1Q7Y3 2QEX2 1M903 1QVF1 1VQN2 3CCV2 1YJ92 1VQ52 1VQM2 1KQS1 1K733 3G4S2
chains in the Genus database with same CATH superfamily
3CC42 3CPW1 2XNDI 3CCL2 2OTJ2 1K9M3 3CMA2 2WSSI 3CC72 3CCU2 2XOKI 1YHQ2 1KC83 1VQ82 1VQL2 3CME2 4YXWI 3CCE2 3CCM2 3CC22 3CCJ2 3CCS2 2OTL2 1VQ62 3CD62 1VQ42 1JJ21 1VQ72 1E79I 1VQO2 1VQK2 1S722 1N8R3 3I552 2QA42 1YJN2 1YIT2 3ZIAI 1YJW2 1K8A3 2WPDI 1M1K3 3G6E2 1VQP2 1QVG1 3G712 1W2B1 3CCR2 3CCQ2 1YI22 1Q813 1NJI3 3I562 3CXC1 3OFNI 1VQ92 1KD13 1Q863 1Q823 1YIJ2 3OW21 1Q7Y3 2QEX2 1M903 1QVF1 1VQN2 3CCV2 2V7QI 1YJ92 1VQM2 1VQ52 1KQS1 1K733 3G4S2
chains in the Genus database with same CATH topology
3CPW1 3CCL2 2OTJ2 1K9M3 3CMA2 3CC72 3CCU2 1YHQ2 1KC83 1VQ82 1VQL2 3CC42 3CME2 3CCE2 3CCM2 3CC22 3CCJ2 3CCS2 2OTL2 1VQ62 3CD62 1VQ42 1JJ21 1VQ72 1VQO2 1VQK2 1S722 1N8R3 3I552 2QA42 1YJN2 1YIT2 1YJW2 1K8A3 1M1K3 3G6E2 1VQP2 1QVG1 3G712 1W2B1 3CCR2 3CCQ2 1YI22 1Q813 1NJI3 3I562 3CXC1 1VQ92 1KD13 1Q863 1Q823 1YIJ2 3OW21 1Q7Y3 2QEX2 1M903 1QVF1 1VQN2 3CCV2 1YJ92 1VQ52 1VQM2 1KQS1 1K733 3G4S2
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CPW 1;  3CCL 2;  2OTJ 2;  1K9M 3;  3CMA 2;  3CC7 2;  3CCU 2;  1YHQ 2;  1KC8 3;  1VQ8 2;  1VQL 2;  3CC4 2;  3CME 2;  3CCE 2;  3CCM 2;  3CC2 2;  3CCJ 2;  3CCS 2;  2OTL 2;  1VQ6 2;  3CD6 2;  1VQ4 2;  1JJ2 1;  1VQ7 2;  1VQO 2;  1VQK 2;  1S72 2;  1N8R 3;  3I55 2;  2QA4 2;  1YJN 2;  1YIT 2;  1YJW 2;  1K8A 3;  1M1K 3;  3G6E 2;  1VQP 2;  1QVG 1;  3G71 2;  1W2B 1;  3CCR 2;  3CCQ 2;  1YI2 2;  1Q81 3;  1NJI 3;  3I56 2;  3CXC 1;  1VQ9 2;  1KD1 3;  1Q86 3;  1Q82 3;  1YIJ 2;  3OW2 1;  1Q7Y 3;  2QEX 2;  1M90 3;  1QVF 1;  1VQN 2;  3CCV 2;  1YJ9 2;  1VQ5 2;  1VQM 2;  1KQS 1;  1K73 3;  3G4S 2; 
#chains in the Genus database with same CATH topology
 3CC4 2;  3CPW 1;  2XND I;  3CCL 2;  2OTJ 2;  1K9M 3;  3CMA 2;  2WSS I;  3CC7 2;  3CCU 2;  2XOK I;  1YHQ 2;  1KC8 3;  1VQ8 2;  1VQL 2;  3CME 2;  4YXW I;  3CCE 2;  3CCM 2;  3CC2 2;  3CCJ 2;  3CCS 2;  2OTL 2;  1VQ6 2;  3CD6 2;  1VQ4 2;  1JJ2 1;  1VQ7 2;  1E79 I;  1VQO 2;  1VQK 2;  1S72 2;  1N8R 3;  3I55 2;  2QA4 2;  1YJN 2;  1YIT 2;  3ZIA I;  1YJW 2;  1K8A 3;  2WPD I;  1M1K 3;  3G6E 2;  1VQP 2;  1QVG 1;  3G71 2;  1W2B 1;  3CCR 2;  3CCQ 2;  1YI2 2;  1Q81 3;  1NJI 3;  3I56 2;  3CXC 1;  3OFN I;  1VQ9 2;  1KD1 3;  1Q86 3;  1Q82 3;  1YIJ 2;  3OW2 1;  1Q7Y 3;  2QEX 2;  1M90 3;  1QVF 1;  1VQN 2;  3CCV 2;  2V7Q I;  1YJ9 2;  1VQM 2;  1VQ5 2;  1KQS 1;  1K73 3;  3G4S 2; 
#chains in the Genus database with same CATH homology
 3CPW 1;  3CCL 2;  2OTJ 2;  1K9M 3;  3CMA 2;  3CC7 2;  3CCU 2;  1YHQ 2;  1KC8 3;  1VQ8 2;  1VQL 2;  3CC4 2;  3CME 2;  3CCE 2;  3CCM 2;  3CC2 2;  3CCJ 2;  3CCS 2;  2OTL 2;  1VQ6 2;  3CD6 2;  1VQ4 2;  1JJ2 1;  1VQ7 2;  1VQO 2;  1VQK 2;  1S72 2;  1N8R 3;  3I55 2;  2QA4 2;  1YJN 2;  1YIT 2;  1YJW 2;  1K8A 3;  1M1K 3;  3G6E 2;  1VQP 2;  1QVG 1;  3G71 2;  1W2B 1;  3CCR 2;  3CCQ 2;  1YI2 2;  1Q81 3;  1NJI 3;  3I56 2;  3CXC 1;  1VQ9 2;  1KD1 3;  1Q86 3;  1Q82 3;  1YIJ 2;  3OW2 1;  1Q7Y 3;  2QEX 2;  1M90 3;  1QVF 1;  1VQN 2;  3CCV 2;  1YJ9 2;  1VQ5 2;  1VQM 2;  1KQS 1;  1K73 3;  3G4S 2; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...