The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
21
|
sequence length |
92
|
structure length |
92
|
Chain Sequence |
GSSGSSGMALSKRELDELKPWIEKTVKRVLGFSEPTVVTAALNCVGKGMDKKKAADHLKPFLDDSTLRFVDKLFEAVEEGRSSRHSSGPSSG
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Solution structure of PWI domain in U4/U6 small nuclear ribonucleoprotein Prp3(hPrp3)
rcsb |
molecule tags |
Rna binding protein
|
source organism |
Homo sapiens
|
molecule keywords |
U4/U6 small nuclear ribonucleoprotein Prp3
|
total genus |
21
|
structure length |
92
|
sequence length |
92
|
ec nomenclature | |
pdb deposition date | 2005-05-14 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF01480 | PWI | PWI domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Up-down Bundle | PWI domain | PWI domain |
#chains in the Genus database with same CATH superfamily 1MP1 A; 3V53 A; 1X4Q A; #chains in the Genus database with same CATH topology 2IW3 A; 2IWH A; 2IX3 A; 3V53 A; 1X4Q A; 1MP1 A; #chains in the Genus database with same CATH homology 2IW3 A; 2IWH A; 2IX3 A; 3V53 A; 1X4Q A; 1MP1 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...