1YA5T

Crystal structure of the titin domains z1z2 in complex with telethonin
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
89
structure length
89
Chain Sequence
MATSELSSEVSEENSERREAFWAEWKDLTLSTRPEEGSSLHEEDTQRHETYHQQGQSQVLVQRSPWLMMRMGILGRGLQEYQLPYQRVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Palindromic assembly of the giant muscle protein titin in the sarcomeric Z-disk
pubmed doi rcsb
molecule tags Structural protein
source organism Homo sapiens
molecule keywords N2B-TITIN ISOFORM
total genus 11
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2004-12-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.160.10 Mainly Beta Single Sheet titin filament fold titin domain like 1ya5T01
2F8VT 1YA5T
chains in the Genus database with same CATH superfamily
2F8VT 1YA5T
chains in the Genus database with same CATH topology
2F8VT 1YA5T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F8V T;  1YA5 T; 
#chains in the Genus database with same CATH topology
 2F8V T;  1YA5 T; 
#chains in the Genus database with same CATH homology
 2F8V T;  1YA5 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...