The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
35
|
sequence length |
146
|
structure length |
146
|
Chain Sequence |
ANYWLYKSEPFKWSWEMQKAKGETGEEWTGVRNYQARNNMRAMKIGDKGFFYHSNEGLDVVGIVEVCALSHPDSTAEGDLKWDCVDIRAVCDMPQPVSLKDVKANPKLEKMSLVTSMRLSVQPVTEEEYLEVCRMGGLANPPKSPD
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Structural genomics reveals EVE as a new ASCH/PUA-related domain.
pubmed doi rcsb |
molecule tags |
Structural genomics, unknown function
|
source organism |
Agrobacterium tumefaciens str. c58
|
molecule keywords |
hypothetical protein Atu2648
|
total genus |
35
|
structure length |
146
|
sequence length |
146
|
ec nomenclature | |
pdb deposition date | 2005-04-11 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF01878 | EVE | EVE domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | Roll | ph1033 like fold | ph1033 like domains |
#chains in the Genus database with same CATH superfamily 2HD9 A; 2ZBN A; 2YU6 A; 4U8T A; 2YUD A; 5DNO A; 5J3E A; 1ZCE A; 1WMM A; 2AR1 A; 2G2X A; 4RCJ A; 4WQN A; 2EVE A; 4RDN A; 3EOP A; 4RDO A; 2GBS A; 4RCI A; 4RCM A; 2P5D A; #chains in the Genus database with same CATH topology 2HD9 A; 2ZBN A; 2YU6 A; 4U8T A; 2YUD A; 5DNO A; 5J3E A; 1ZCE A; 1WMM A; 2AR1 A; 2G2X A; 4RCJ A; 4WQN A; 2EVE A; 4RDN A; 3EOP A; 4RDO A; 2GBS A; 4RCI A; 4RCM A; 2P5D A; #chains in the Genus database with same CATH homology 2HD9 A; 2ZBN A; 2YU6 A; 4U8T A; 2YUD A; 5DNO A; 5J3E A; 1ZCE A; 1WMM A; 2AR1 A; 2G2X A; 4RCJ A; 4WQN A; 2EVE A; 4RDN A; 3EOP A; 4RDO A; 2GBS A; 4RCI A; 4RCM A; 2P5D A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...