1AGGA

The solution structure of omega-aga-ivb, a p-type calcium channel antagonist from the venom of agelenopsis aperta
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
48
structure length
48
Chain Sequence
EDNCIAEDYGKCTWGGTKCCRGRPCRCSMIGTNCECTPRLIMEGLSFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Neurotoxin
molecule keywords OMEGA-AGATOXIN-IVB
publication title The solution structure of omega-Aga-IVB, a P-type calcium channel antagonist from venom of the funnel web spider, Agelenopsis aperta.
pubmed doi rcsb
total genus 5
structure length 48
sequence length 48
ec nomenclature
pdb deposition date 1995-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02819 Toxin_9 Spider toxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.40.10 Few Secondary Structures Irregular Omega-AgatoxinV Omega-AgatoxinV 1aggA00
1IVAA 2ROOA 1QDPA 1G9PA 1OAVA 1AGGA 1VTXA 1OMAA 1OAWA
chains in the Genus database with same CATH superfamily
1HY9A 1IVAA 1XI7A 1BOEA 2ROOA 2DCVA 2DCWA 1QDPA 1G9PA 1OAVA 1AGGA 1VTXA 1CIXA 1OMAA 1H59B 1XJ1A 1OAWA
chains in the Genus database with same CATH topology
1IVAA 1XI7A 1BOEA 2ROOA 2DCVA 2DCWA 1QDPA 1G9PA 1OAVA 1AGGA 1VTXA 1CIXA 1OMAA 1H59B 1XJ1A 1OAWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IVA A;  2ROO A;  1QDP A;  1G9P A;  1OAV A;  1AGG A;  1VTX A;  1OMA A;  1OAW A; 
#chains in the Genus database with same CATH topology
 1HY9 A;  1IVA A;  1XI7 A;  1BOE A;  2ROO A;  2DCV A;  2DCW A;  1QDP A;  1G9P A;  1OAV A;  1AGG A;  1VTX A;  1CIX A;  1OMA A;  1H59 B;  1XJ1 A;  1OAW A; 
#chains in the Genus database with same CATH homology
 1IVA A;  1XI7 A;  1BOE A;  2ROO A;  2DCV A;  2DCW A;  1QDP A;  1G9P A;  1OAV A;  1AGG A;  1VTX A;  1CIX A;  1OMA A;  1H59 B;  1XJ1 A;  1OAW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...