The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
1
|
sequence length |
44
|
structure length |
44
|
Chain Sequence |
GSGLSAQDISQPLQNSFIHTGHGDSDPRHCWGFPDRIDELYLGN
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Structure of the small G protein Cdc42 bound to the GTPase-binding domain of ACK.
pubmed doi rcsb |
molecule keywords |
PROTEIN (CDC42 HOMOLOG)
|
molecule tags |
Transferase
|
source organism |
Homo sapiens
|
total genus |
1
|
structure length |
44
|
sequence length |
44
|
ec nomenclature |
ec
2.7.10.2: Non-specific protein-tyrosine kinase. |
pdb deposition date | 1999-03-23 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Few Secondary Structures | Irregular | Activated P21cdc42hs Kinase; Chain B | Cdc42-like binding domain |
#chains in the Genus database with same CATH superfamily 1CF4 B; #chains in the Genus database with same CATH topology 1CF4 B; #chains in the Genus database with same CATH homology 1CF4 B;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...