1CIXA

Three-dimensional structure of antimicrobial peptide tachystatin a isolated from horseshoe crab
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
44
structure length
44
Chain Sequence
YSRCQLQGFNCVVRSYGLPTIPCCRGLTCRSYFPGSTYGRCQRY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antimicrobial peptide
molecule keywords PROTEIN (TACHYSTATIN A)
publication title Structure of the antimicrobial peptide tachystatin A.
pubmed doi rcsb
total genus 3
structure length 44
sequence length 44
ec nomenclature
pdb deposition date 1999-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11406 Tachystatin_A Antimicrobial peptide tachystatin A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.40.20 Few Secondary Structures Irregular Omega-AgatoxinV Omega-AgatoxinV 1cixA00
1BOEA 1CIXA 1XJ1A 1H59B 1XI7A 2DCWA 2DCVA
chains in the Genus database with same CATH superfamily
1BOEA 1OAVA 1CIXA 1OAWA 1OMAA 1VTXA 1XJ1A 1H59B 1QDPA 2ROOA 1G9PA 1HY9A 1AGGA 1XI7A 1IVAA 2DCWA 2DCVA
chains in the Genus database with same CATH topology
1BOEA 1OAVA 1CIXA 1OAWA 1OMAA 1VTXA 1XJ1A 1H59B 1QDPA 2ROOA 1G9PA 1AGGA 1XI7A 1IVAA 2DCWA 2DCVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BOE A;  1CIX A;  1XJ1 A;  1H59 B;  1XI7 A;  2DCW A;  2DCV A; 
#chains in the Genus database with same CATH topology
 1BOE A;  1OAV A;  1CIX A;  1OAW A;  1OMA A;  1VTX A;  1XJ1 A;  1H59 B;  1QDP A;  2ROO A;  1G9P A;  1HY9 A;  1AGG A;  1XI7 A;  1IVA A;  2DCW A;  2DCV A; 
#chains in the Genus database with same CATH homology
 1BOE A;  1OAV A;  1CIX A;  1OAW A;  1OMA A;  1VTX A;  1XJ1 A;  1H59 B;  1QDP A;  2ROO A;  1G9P A;  1AGG A;  1XI7 A;  1IVA A;  2DCW A;  2DCV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...