1CO4A

Solution structure of a zinc domain conserved in yeast copper-regulated transcription factors
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
42
structure length
42
Chain Sequence
MVVINGVKYACDSCIKSHKAAQCEHNDRPLKILKPRGRPPTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of a zinc domain conserved in yeast copper-regulated transcription factors.
pubmed doi rcsb
molecule keywords PROTEIN (ACTIVATOR OF METALLOTHIONEIN 1)
molecule tags Translation/regulation protein
total genus 5
structure length 42
sequence length 42
ec nomenclature
pdb deposition date 1999-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00649 Copper-fist Copper fist DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.430.10 Alpha Beta Alpha-Beta Complex Activator Of Metallothionein 1; Chain A Copper fist DNA-binding domain 1co4A00
1CO4A
chains in the Genus database with same CATH superfamily
1CO4A
chains in the Genus database with same CATH topology
1CO4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CO4 A; 
#chains in the Genus database with same CATH topology
 1CO4 A; 
#chains in the Genus database with same CATH homology
 1CO4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...