1D0RA

Solution structure of glucagon-like peptide-1-(7-36)-amide in trifluoroethanol/water
Total Genus 12

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
30
structure length
30
Chain Sequence
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
AH1 (7-26)TIV2 (4-7)EMPTYTIV3 (26-29)TIV1 (2-5)Updating...
connected with : NaN
molecule tags Hormone/growth factor
source organism Homo sapiens
publication title Structure and Folding of Glucagon-like Peptide-1-(7-36)-amide in Trifluoroethanol Studied by NMR
pubmed doi rcsb
molecule keywords GLUCAGON-LIKE PEPTIDE-1-(7-36)-AMIDE
total genus 12
structure length 30
sequence length 30
ec nomenclature
pdb deposition date 1999-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00123 Hormone_2 Peptide hormone
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.