1E68A

Solution structure of bacteriocin as-48
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
70
structure length
70
Chain Sequence
MAKEFGIPAAVAGTVLNVVEAGGWVTTIVSILTAVGSGGLSLLAAAGRESIKAYLKKEIKKKGKRAVIAW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antibiotic
molecule keywords AS-48 PROTEIN
publication title Bacteriocin as-48, a Microbial Cyclic Polypeptide Structurally and Functionally Related to Mammalian Nk-Lysin
pubmed doi rcsb
total genus 22
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2000-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09221 Bacteriocin_IId Bacteriocin class IId cyclical uberolysin-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.225.10 Mainly Alpha Up-down Bundle Bacteriocin As-48; Chain A Bacteriocin AS-48 1e68A00
1E68A 1O82A 4RGDA 1O84A 1O83A 2KJFA 2MP8A
chains in the Genus database with same CATH superfamily
4BF9A 1E68A 1O82A 3W9ZA 4YCPA 4RGDA 1O84A 4YCOA 2KSNA 1O83A 2KJFA 4BFAA 2MP8A
chains in the Genus database with same CATH topology
1E68A 1O82A 4RGDA 1O84A 1O83A 2KJFA 2MP8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E68 A;  1O82 A;  4RGD A;  1O84 A;  1O83 A;  2KJF A;  2MP8 A; 
#chains in the Genus database with same CATH topology
 4BF9 A;  1E68 A;  1O82 A;  3W9Z A;  4YCP A;  4RGD A;  1O84 A;  4YCO A;  2KSN A;  1O83 A;  2KJF A;  4BFA A;  2MP8 A; 
#chains in the Genus database with same CATH homology
 1E68 A;  1O82 A;  4RGD A;  1O84 A;  1O83 A;  2KJF A;  2MP8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...