1EV0A

Solution structure of the mine topological specificity domain
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
58
structure length
58
Chain Sequence
b'RSDAEPHYLPQLRKDILEVICKYVQIDPEMVTVQLEQKDGDISILELNVTLPEAEELK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MINE
publication title Structural basis for the topological specificity function of MinE.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell cycle
total genus 8
structure length 58
sequence length 58
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-04-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1070.10 Alpha Beta 2-Layer Sandwich Cell Cycle; Chain A Cell division topological specificity factor MinE 1ev0A00
2KXOA 3KU7A 1EV0A 3MCDA
chains in the Genus database with same CATH superfamily
3MCDA 3KU7A 1EV0A 2KXOA 2GJHA
chains in the Genus database with same CATH topology
2KXOA 3KU7A 1EV0A 3MCDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KXO A;  3KU7 A;  1EV0 A;  3MCD A; 
#chains in the Genus database with same CATH topology
 3MCD A;  3KU7 A;  1EV0 A;  2KXO A;  2GJH A; 
#chains in the Genus database with same CATH homology
 2KXO A;  3KU7 A;  1EV0 A;  3MCD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...