1EXEA

Solution structure of a mutant of transcription factor 1.
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
99
structure length
99
Chain Sequence
MNKTELIKAIAQDTGLTQVSVSKMLASFEKIITETVAKGDKVQLTGFLNIKPVARQARKGFNPQTQEALEIAPSVGVSVKPGESLKKAAEGLKYEDFAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords TRANSCRIPTION FACTOR 1
publication title Solution structure of a mutant of transcription factor 1: implications for enhanced DNA binding.
pubmed doi rcsb
source organism Bacillus phage spo1
total genus 18
structure length 99
sequence length 99
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00216 Bac_DNA_binding Bacterial DNA-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.520.10 Few Secondary Structures Irregular HU Protein; Chain A IHF-like DNA-binding proteins 1exeA00
1HUUA 2NDPA 4P3VA 4QJNA 1WTUA 1B8ZA 2HT0A 4YEWC 1OUZA 1P71A 1IHFB 1MULA 5FBMA 4YEYA 2O97A 4YFHA 2NP2A 1P78A 5EKAA 1P51A 1IHFA 4YEWA 2IIFA 1OWGB 4FMRA 1OWFB 5L8ZA 4YFTC 4YF0A 1EXEA 4PT4A 1OWGA 1HUEA 1OWFA 4QJUA 4N1VA 3RHIA 1OUZB 4YEXA 2HT0B 4YFTA 2IIEA 1RIYA 2O97B 4DKYA
chains in the Genus database with same CATH superfamily
1HUUA 2NDPA 4P3VA 4QJNA 1WTUA 1B8ZA 2HT0A 4YEWC 1OUZA 1P71A 1IHFB 1MULA 5FBMA 4YEYA 2O97A 4YFHA 2NP2A 1P78A 5EKAA 1P51A 1IHFA 4YEWA 2IIFA 1OWGB 4FMRA 1OWFB 5L8ZA 4YFTC 4YF0A 1EXEA 4PT4A 1OWGA 1HUEA 1OWFA 4QJUA 4N1VA 3RHIA 1OUZB 4YEXA 2HT0B 4YFTA 2IIEA 1RIYA 2O97B 4DKYA
chains in the Genus database with same CATH topology
1HUUA 2NDPA 4P3VA 4QJNA 1WTUA 1B8ZA 2HT0A 4YEWC 1OUZA 1P71A 1IHFB 1MULA 5FBMA 4YEYA 2O97A 4YFHA 2NP2A 1P78A 5EKAA 1P51A 1IHFA 4YEWA 2IIFA 1OWGB 4FMRA 1OWFB 5L8ZA 4YFTC 4YF0A 1EXEA 4PT4A 1OWGA 1HUEA 1OWFA 4QJUA 4N1VA 3RHIA 1OUZB 4YEXA 2HT0B 4YFTA 2IIEA 1RIYA 2O97B 4DKYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HUU A;  2NDP A;  4P3V A;  4QJN A;  1WTU A;  1B8Z A;  2HT0 A;  4YEW C;  1OUZ A;  1P71 A;  1IHF B;  1MUL A;  5FBM A;  4YEY A;  2O97 A;  4YFH A;  2NP2 A;  1P78 A;  5EKA A;  1P51 A;  1IHF A;  4YEW A;  2IIF A;  1OWG B;  4FMR A;  1OWF B;  5L8Z A;  4YFT C;  4YF0 A;  1EXE A;  4PT4 A;  1OWG A;  1HUE A;  1OWF A;  4QJU A;  4N1V A;  3RHI A;  1OUZ B;  4YEX A;  2HT0 B;  4YFT A;  2IIE A;  1RIY A;  2O97 B;  4DKY A; 
#chains in the Genus database with same CATH topology
 1HUU A;  2NDP A;  4P3V A;  4QJN A;  1WTU A;  1B8Z A;  2HT0 A;  4YEW C;  1OUZ A;  1P71 A;  1IHF B;  1MUL A;  5FBM A;  4YEY A;  2O97 A;  4YFH A;  2NP2 A;  1P78 A;  5EKA A;  1P51 A;  1IHF A;  4YEW A;  2IIF A;  1OWG B;  4FMR A;  1OWF B;  5L8Z A;  4YFT C;  4YF0 A;  1EXE A;  4PT4 A;  1OWG A;  1HUE A;  1OWF A;  4QJU A;  4N1V A;  3RHI A;  1OUZ B;  4YEX A;  2HT0 B;  4YFT A;  2IIE A;  1RIY A;  2O97 B;  4DKY A; 
#chains in the Genus database with same CATH homology
 1HUU A;  2NDP A;  4P3V A;  4QJN A;  1WTU A;  1B8Z A;  2HT0 A;  4YEW C;  1OUZ A;  1P71 A;  1IHF B;  1MUL A;  5FBM A;  4YEY A;  2O97 A;  4YFH A;  2NP2 A;  1P78 A;  5EKA A;  1P51 A;  1IHF A;  4YEW A;  2IIF A;  1OWG B;  4FMR A;  1OWF B;  5L8Z A;  4YFT C;  4YF0 A;  1EXE A;  4PT4 A;  1OWG A;  1HUE A;  1OWF A;  4QJU A;  4N1V A;  3RHI A;  1OUZ B;  4YEX A;  2HT0 B;  4YFT A;  2IIE A;  1RIY A;  2O97 B;  4DKY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...