The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
3
|
sequence length |
71
|
structure length |
46
|
Chain Sequence |
SGNTGSIINNYYMQQYQNSMDTQLGNDWFSKLASSAFSGLFGALLA
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
The structure and antigenicity of a type C foot-and-mouth disease virus.
pubmed doi rcsb |
| molecule tags |
Virus
|
| source organism |
Foot-and-mouth disease virus
|
| molecule keywords |
FOOT-AND-MOUTH DISEASE VIRUS (SUBUNIT VP1)
|
| total genus |
3
|
| structure length |
46
|
| sequence length |
71
|
| ec nomenclature |
ec
2.7.7.48: RNA-directed RNA polymerase. |
| pdb deposition date | 1994-02-10 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| 4 | PF08935 | VP4_2 | Viral protein VP4 subunit |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Few Secondary Structures | Irregular | Foot-And-Mouth Disease Virus, subunit 4 | Capsid protein VP4 superfamily, Picornavirus |
#chains in the Genus database with same CATH superfamily 4GH4 D; 5DDJ 4; 2MEV 4; 5ACA 4; 1FMD 4; 1MEC 4; 5D8A D; 5AC9 4; 2WZR 4; 4IV1 D; 1FOD 4; 1ZBA 4; 1BBT 4; 1ZBE 4; 1QQP 4; #chains in the Genus database with same CATH topology 4GH4 D; 5DDJ 4; 2MEV 4; 5ACA 4; 1FMD 4; 1MEC 4; 5D8A D; 5AC9 4; 2WZR 4; 4IV1 D; 1FOD 4; 1ZBA 4; 1BBT 4; 1ZBE 4; 1QQP 4; #chains in the Genus database with same CATH homology 4GH4 D; 5DDJ 4; 2MEV 4; 5ACA 4; 1FMD 4; 1MEC 4; 5D8A D; 5AC9 4; 2WZR 4; 4IV1 D; 1FOD 4; 1ZBA 4; 1BBT 4; 1ZBE 4; 1QQP 4;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
