1GP8A

Nmr solution structure of the coat protein-binding domain of bacteriophage p22 scaffolding protein
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
40
structure length
40
Chain Sequence
ITGDVSAANKDAIRKQMDAAASKGDVETYRKLKAKLKGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the coat protein-binding domain of the scaffolding protein from a double-stranded DNA virus.
pubmed doi rcsb
molecule keywords PROTEIN (SCAFFOLDING PROTEIN)
molecule tags Viral protein
source organism Enterobacteria phage p22
total genus 10
structure length 40
sequence length 40
ec nomenclature
pdb deposition date 1999-05-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.810.10 Few Secondary Structures Irregular Virus Scaffolding Protein; Chain A Virus Scaffolding Protein; Chain A 1gp8A00
1GP8A 2GP8A
chains in the Genus database with same CATH superfamily
1GP8A 2GP8A
chains in the Genus database with same CATH topology
1GP8A 2GP8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GP8 A;  2GP8 A; 
#chains in the Genus database with same CATH topology
 1GP8 A;  2GP8 A; 
#chains in the Genus database with same CATH homology
 1GP8 A;  2GP8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...